Recombinant Mouse Beta-nerve growth factor (Ngf) (Active)

Unavailable
Code CSB-AP004101MO
MSDS
Size $136
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 2 ng/ml.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
Ngf; Ngfb; Beta-nerve growth factor; Beta-NGF
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
122-241aa
Complete Sequence
SSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG
Mol. Weight
13.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
Tag-Free
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 μm Filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades to regulate neuronal proliferation, differentiation and survival. The immature NGF precursor (proNGF) functions as ligand for the heterodimeric receptor formed by SORCS2 and NGFR, and activates cellular signaling cascades that lead to inactivation of RAC1 and/or RAC2, reorganization of the actin cytoskeleton and neuronal growth cone collapse. In contrast to mature NGF, the precursor form (proNGF) promotes neuronal apoptosis (in vitro). Inhibits metalloproteinase-dependent proteolysis of platelet glycoprotein VI. Binds lysophosphatidylinositol and lysophosphatidylserine between the two chains of the homodimer. The lipid-bound form promotes histamine relase from mast cells, contrary to the lipid-free form.
Gene References into Functions
  1. The authors described a long-distance signaling mechanism of Porcine hemagglutinating encephalomyelitis virus-driven deficits in neurons and suggested that such Ulk1 repression may result in limited NGF/TrkA retrograde signaling within activated Rab5 endosomes, explaining the progressive failure of neurite outgrowth and survival. PMID: 29875237
  2. Mechanoinsensitive ''silent'' nociceptors are characterized by the expression of the nicotinic acetylcholine receptor subunit alpha-3 (CHRNA3); the mechanically gated ion channel PIEZO2 mediates NGF-induced mechanosensitivity in these neurons. PMID: 29241539
  3. antibodies raised against NGF, TrkA, and p75 (also known as CD271) were used to explore the expression of these antigens in the non-decalcified young mouse femur. PMID: 29166838
  4. An inducible mouse model that can dissect the contribution of autocrine direct action of cleavage-resistant proNGF on systemic microvascular abnormalities in both retina and kidney, major targets for microvascular complication. PMID: 29253516
  5. both in vivo mechanical loading and in vitro mechanical stretch were shown to induce the profound up-regulation of NGF in osteoblasts within 1 h of loading. PMID: 28416686
  6. Nerve growth factor negatively regulates bone marrow granulopoiesis during small intestinal inflammation PMID: 26683342
  7. This study may represent a common mechanism for selective follicular activation induced by a localized increase in NGF in interstitial cells and mediated via the mTOR signaling pathway. PMID: 28542147
  8. nerve growth factor (NGF) signaling through neurotrophic tyrosine kinase receptor type 1 (TrkA) directs innervation of the developing mouse femur to promote vascularization and osteoprogenitor lineage progression. PMID: 27568565
  9. Mechanical stress-induced upregulation of NGF in colon SMC underlies the visceral hypersensitivity in bowel obstruction through increased gene expression and activity of tetrodotoxin-resistant Na channels in sensory neurons. PMID: 28079757
  10. results suggest that perivascular nerves innervate neovessels as neovasculatures mature and that NGF accelerates the innervation of perivascular nerves in neovessels. PMID: 27493098
  11. These findings reveal a non-neuronal role for neurotrophins and identify a new regulatory pathway in insulin secretion that can be targeted to ameliorate beta cell dysfunction. PMID: 27825441
  12. NGF signalling directly controls basal APP phosphorylation, subcellular localization and BACE cleavage. PMID: 27076121
  13. NGF facilitates OVA with lowLPS-induced maturation of mouse BMDCs through LPS-up-regulated p75 NTR via activation of NF-kappaB pathways, providing another mechanism for the involvement of NGF in the Th2 response PMID: 27437725
  14. NGF-OE mice exhibit age-dependent increases in Substance P and CGRP in the urothelium and hyperinnervation of the bladder. PMID: 27342083
  15. TNF-alpha upregulated Nerve Growth Factor [NGF] expression in synovial fibroblasts and macrophages and IL-1beta upregulated NGF expression in synovial fibroblasts. IL-1beta and TNF-alpha may regulate NGF signaling in Osteoarthritic joints and be suitable therapeutic targets for treating Osteoarthritis pain PMID: 27635406
  16. functional PAP(thorn) neurons are essential for the analgesic effect, which is mediated by NGF-trkA signaling. PMID: 27306411
  17. NGF negatively regulates growth cone retrograde actin flow on laminin. PMID: 26631553
  18. In E-Reeler retinas, NGF was significantly increased in retinal ganglion cells and glial cells. E-Reeler retinal bipolar cells and RGCs overexpress NGF and p75(NTR) as a protective endogenous response to Reelin deprivation. PMID: 26066836
  19. The NGF-induced up-regulation of TRPV1 via the increased synthesis and release of endogenous CGRP leads to improved cardiac performance in I/R-injured diabetic heart. PMID: 25650182
  20. NGF effects on parasympathetic nerves may regulate airway smooth muscle. PMID: 25647301
  21. Ginger extract has a synaptogenic effect via NGF-induced ERK/CREB activation, resulting in memory enhancement. PMID: 25049196
  22. Proinflammatory cytokines in osteoarthritis (OA) joints and the increased mechanical loading of cartilage may mediate OA pain via the stimulation of NGF expression and release by chondrocytes PMID: 24438745
  23. Despite being highly conserved, NGF and proNGF of mouse and human origins show distinct properties.Special care must be taken in performing experiments with cross-species systems. PMID: 25496838
  24. NGF exhibits anti-oxidative and hepatoprotective effects and is suggested to be therapeutically applicable in treating cholestatic liver diseases. PMID: 25397406
  25. Results indicate that analgesic effect of CB1 activation may in part be due to inhibition of NGF-induced sensitization of TRPV1 and also that the effect of CB1 activation is at least partly mediated by attenuation of NGF-induced increased PI3 signaling PMID: 25088915
  26. NGF induces removal of active caspase-3 in a lysosome-dependent manner. PMID: 24787014
  27. These results indicate that NGF exerts antileishmanial effect by stimulating hydrogen peroxide production in macrophages. PMID: 24937592
  28. iron accumulation induces NGF expression in hepatocytes, which in turn leads to LSEC defenestration via TrkA PMID: 25460199
  29. These findings suggest that overexpression of NGF in the ovary may suffice to cause both reproductive and metabolic alterations characteristic of polycystic ovary-like syndrome (PCOS) and support the hypothesis that sympathetic hyperactivity may contribute to the development and/or progression of PCOS. PMID: 25211588
  30. The increased NGF concentrations abolish Sema3A-induced inhibitory effect on axon outgrowth, while they have no effect on Sema3A-induced collapse rate. PMID: 24338202
  31. Data suggest that proNGF may appeal a new pathway or possible mechanism underlying microglial toxicity in the neuroinflammation and a potential target for therapeutic manipulation of the neurodegenerative diseases. PMID: 24040063
  32. beta-NGF gene transfection promotes the differentiation of bone marrow stromal stem cells into neurons through regulation of AKT and MAPKs signaling pathways. PMID: 23934089
  33. mechanical stimulation may attenuate NGFbeta signaling through Rac1 PMID: 23989259
  34. Independent of genotype, folate deficiency affects NGF levels in the frontal cortex, amygdala and hippocampus. PMID: 23623989
  35. calcineurin/NFAT pathway mediates the upregulation of PAI-1 by NGF PMID: 23825664
  36. ProNGF\NGF imbalance triggers learning and memory deficits, neurodegeneration and spontaneous epileptic-like discharges in transgenic mice. PMID: 23538417
  37. elevated levels of NGF in target tissues stimulate sympathetic and sensory axonal sprouting PMID: 23322532
  38. PIP5Kalpha acts as a negative regulator of nerve growth factor-induced neurite outgrowth by inhibiting PI3K/Akt signaling pathway in PC12 cells. PMID: 23538529
  39. Data suggest that diet factors (i.e., olive pomace polyphenols) up-regulate NGF/TrkA (proto-oncogene trk) and BDNF/TrkB (brain derived neurotrophic factor/receptor) in hippocampus/olfactory bulb and down-regulate NGF/BDNF in frontal cortex/striatum. PMID: 23466052
  40. Data suggest that expression of NGF is down-regulated in wounded skin (epidermis) in diabetes; among the growth factors investigated, only expression of NGF was down-regulated in healing skin wounds of diabetic mice as compared to nondiabetic mice. PMID: 23426701
  41. proNGF selectively promotes the growth of neurites from a subset of NGF-responsive neurons by a p75(NTR)-dependent mechanism during postnatal development when the axons of these neurons are ramifying within their targets in vivo PMID: 23633509
  42. Overexpression of mouse NGF in urothelium & detrusor affected transcription of PAC1, VPAC1, VPAC2, PAPCAP, VIP & other peptides normally & in cyclophosphamide-induced cystitis. The changes were tissue- and disease-duration dependent. PMID: 22700375
  43. The HTM1 heterodimer of 2 NGF muteins binds p75 and TrkA on opposite sides of the heterodimer, but not 2 TrkA receptors, supporting the ligand passing of NGF from p75 to TrkA via a transient heteroreceptor complex of p75-NGF-TrkA. PMID: 22903500
  44. Our results suggest that BDNF-TrkB but not NGF-TrkA signaling is involved in the brain repair after ICH, and early proper treadmill exercise might promote this repair process. PMID: 22999926
  45. Expression of NGF in hippocampus, cortex, and adrenal gland of wild type animal tended to decrease following spaceflight. PMID: 22808101
  46. This study demonstrated that both TrkA and NGF support the survival of only a subset of basal forebrain cholinergic neuron during brain development. PMID: 23100411
  47. Letter: NGF-p75 and neuropsin/KLK8 pathways may cooperate in regulation of epidermal homeostasis in inflamed skin. PMID: 22520925
  48. that NGF derived from bronchial and alveolar epithelium plays an important role in airway hyperresponsiveness after chronic exposure to mite antigen PMID: 22168511
  49. Therapeutic potential of NGF for the prevention of cardiomyopathy in diabetic subjects. PMID: 22187379
  50. NGF exerts profibrotic activities in the airways by inducing type III collagen production in fibroblasts PMID: 21816457

Show More

Hide All

Subcellular Location
Secreted. Endosome lumen.
Protein Families
NGF-beta family
Tissue Specificity
Detected in submaxillary gland (at protein level). Highly expressed in male submaxillary gland. Levels are much lower in female submaxillary gland.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*