Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized ICOSLG at 2 μg/ml can bind human ICOS (CSB-MP707478HU), the EC50 of human ICOSLG protein is 29.04-43.59 ng/ml.
Alternative Names
ICOSLG; B7H2; B7RP1; ICOSL; KIAA0653; ICOS ligand; B7 homolog 2; B7-H2; B7-like protein Gl50; B7-related protein 1; B7RP-1; CD antigen CD275
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
19-258aa
Target Protein Sequence
DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWS
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Human ICOS ligand (ICOSLG) amino acid Asp19-Ser258, with an N-terminal linker, and a C-terminal 6xHis-tag, was expressed in mammalian cells. The product is the recombinant human ICOSLG protein. It is an active protein whose bioactivity has been measured by its binding ability with the human ICOS receptor in a functional ELISA. The EC50 of human ICOSLG protein is 29.04-43.59 ng/ml. The purity of this ICOSLG protein reaches up to 95% determined by SDS-PAGE. It has an apparent molecular mass of 40 kDa on SDS-PAGE while its predicted mass is 28.9 kDa. Glycosylation causes this result. Its endotoxin level is less than 1.0 EU/ug measured by the LAL method. And it is in stock now.
ICOSLG is the ligand for inducible costimulatory molecule (ICOS). ICOS-ICOSLG interaction delivers the co-stimulatory signals that facilitate the activation and differential of T cells. Dysregulation of the ICOS-ICOSLG pathway has been associated with autoimmune diseases and cancer and is a potential immune checkpoint blockade.
