Recombinant Human IGF-like family receptor 1 (IGFLR1), partial (Active)

In Stock
Code CSB-MP862025HU
MSDS
Size $268
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 μg/ml can bind Human IGFL1 (CSB-MP764932HU), the EC50 is 32.33-47.52 ng/mL.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 μg/mL can bind Human IGFL1 (CSB-MP764932HU), the EC50 is 32.33-47.52 ng/mL.
Target Names
Uniprot No.
Alternative Names
(Transmembrane protein 149)(U2 small nuclear RNA auxiliary factor 1-like 4)
Molecular Characterization
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
23-163aa
Target Protein Sequence
SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP
Mol. Weight
17.4 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Human IGFLR1 (TMEM149, U2AF1L4) recombinant protein was produced in Mammalian cell, where the gene sequence encoding Human IGFLR1 (23-163aa) was expressed with the C-terminal 6xHis tag. The purity of this IGFLR1 protein was greater than 95% by SDS-PAGE. The activity was measured by its binding ability in a functional ELISA.

IGFLR1 may also be involved in the immune system as a member of the TNF receptor family. Studies have found that in colorectal cancer, IGFLR1 is highly expressed on the surface of CD8+ T cells and has the function of depleting T cells. Inhibiting the expression of IGFLR1 may slow the progression of colorectal cancer tumors. In colorectal cancer patients, CXCL13+TH1-like cells may affect the therapeutic effect of immune checkpoint inhibitors. IGFLR1 is a type of receptor protein that is highly expressed on CXCL13+TH1-like cells. In vitro experiments in vivo demonstrated that IGFLR1, as a co-stimulatory factor, may become a potential drug therapy target.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.
Gene References into Functions
  1. Murine insulin growth factor-like (IGFL) and human IGFL1 proteins are induced in inflammatory skin conditions and bind to a novel tumor necrosis factor receptor family member, IGFLR1. PMID: 21454693
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Database Links

HGNC: 23620

OMIM: 614143

KEGG: hsa:79713

STRING: 9606.ENSP00000246532

UniGene: Hs.352548

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*