Recombinant Rat Intestinal-type alkaline phosphatase 1 (Alpi) (Active)

In Stock
Code CSB-MP001627RA
MSDS
Size $318
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Unit Definition:One unit is defined as the amount of enzyme required to cleave 1 nmol p-nitro-phenylphosphate(pNPP), in 1 minute at 37°C, pH10.0.The specific activity is >10370.37 U/mg.
Target Names
Uniprot No.
Alternative Names
(IAP-1)(Intestinal alkaline phosphatase 1)(Intestinal alkaline phosphatase I)(IAP-I)
Molecular Characterization
Species
Rattus norvegicus (Rat)
Source
Mammalian cell
Expression Region
21-511aa
Target Protein Sequence
VIPVEEENPVFWNQKAKEALDVAKKLQPIQTSAKNLILFLGDGMGVPTVTATRILKGQLGGHLGPETPLAMDHFPFTALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGVSAAARFNQCNSTFGNEVFSVMHRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRDWYSDADMPSSALQEGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPGDSDQSGVRLDSRNLVEEWLAKYQGTRYVWNREQLMQASQDPAVTRLMGLFEPTEMKYDVNRNASADPSLAEMTEVAVRLLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLTLITADHSHVFAFGGYTLRGTSIFGLAPLNAQDGKSYTSILYGNGPGYVLNSGNRPNVTDAESGDVNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPADENRPTTPVQN
Mol. Weight
55.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

To creat active recombinant rat intestinal-type alkaline phosphatase (Alpi) in mammalian cells, the gene region encoding amino acids 21-511 of the rat Alpi protein is inserted into an expression vector containing an N-terminal 10xHis-tag. The recombinant vector is then transfected into mammalian cells using transfection techniques. The transfected cells are cultured to allow the expression of the recombinant Alpi protein. After expression, the cells are collected, and the recombinant protein is purified from the cell lysate. The purified recombinant Alpi protein demonstrates a purity exceeding 95% based on SDS-PAGE analysis. The specific activity of the recombinant Alpi protein is measured to be greater than 10370.37 U/mg, confirming its enzymatic function. Additionally, the endotoxin level of the recombinant Alpi protein is determined to be less than 1.0 EU/μg using the LAL method.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : Binding assay/Protein-protein interaction

Review: I used the CSB-MP001627RA product to develop a competitive ELISA method, and the results showed that the protein had good binding activity, stable properties, and excellent repeatability, and all parameter indicators met the standards. It is a repeat purchase, and I will continue to purchase this product.

By Anonymous

Target Background

Function
Alkaline phosphatase that can hydrolyze various phosphate compounds.
Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Protein Families
Alkaline phosphatase family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*