Recombinant Bovine Cation-independent mannose-6-phosphate receptor (IGF2R), partial

Code CSB-MP011093BOe1
MSDS
Size $826
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Species
Bos taurus (Bovine)
Source
Mammalian cell
Expression Region
628-772aa
Target Protein Sequence
LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
18.4 kDa
Protein Length
Partial
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant bovine cation-independent mannose-6-phosphate receptor (IGF2R) is produced through the following steps: inserting the DNA fragment encoding the 628-772 amino acid region of bovine IGF2R into a suitable expression vector, transfecting mammalian cells with the recombinant expression vector, selecting the transfected cells and expanding them, culturing the transfected cells in appropriate conditions, harvesting and purifying the recombinant IGF2R protein from the cell lysate. The purity of the recombinant bovine IGF2R protein exceeds 90% as determined by SDS-PAGE analysis. It migrates as a band with a molecular weight of 26 kDa on the gel. This recombinant bovine IGF2R protein can be used in studies related to IGF2R-associated immunology.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates the transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelysosomal compartment where the low pH mediates the dissociation of the complex. The receptor is then recycled back to the Golgi for another round of trafficking through its binding to the retromer. This receptor also binds IGF2. Acts as a positive regulator of T-cell coactivation by binding DPP4.
Gene References into Functions
  1. suggest that the insulin like growth factor 2 receptor(IGF2R) gene polymorphisms could be useful genetic markers for dairy production traits in cattle PMID: 29785901
  2. study hypothesizes that reduced granulosa cell insulin-like growth factor II receptor expression in F2 follicles of Twinner cows may play a role in the development of 2 or more dominant follicles PMID: 24209503
  3. imprinting of Bos taurus IGF2R is similar to mouse except in placenta, which could indicate an effect of reproductive strategy PMID: 23593146
  4. Increases in CYP19A1 and FSHR mRNA expression and decreases in IGF2R mRNA expression in follicles of Twinners support the hypothesis that increased follicular development and steroidogenesis result from increased extra-ovarian IGF-1 production. PMID: 22266997
  5. Sex-sorting procedure by flow cytometry did not affect the overall DNA methylation patterns of the IGF2 and IGF2R genes, although individual variation in their methylation patterns among bulls was observed. PMID: 22128039
  6. Study demonstrates associations between IGF2R polymorphisms and growth- and body-related traits in cattle. PMID: 22221028
  7. Data describes the long-term changes to skeletal muscle growth and IGF1, 2, 1R, and 2R mRNA expression in progeny after exposure to high and low levels of maternal nutrient intake during the first two trimesters of gestation in the bovine. PMID: 21056085
  8. Expression and binding properties of mannose-6-phosphate receptors CD-MPR and CI-MPR differ during perinatal development in rat liver. PMID: 12127995
  9. the interaction between uPAR and Man-6-P/IGF2R is a low percentage binding event and that suPAR and full-length uPAR bind the Man-6-P/IGF2R by different mechanisms. PMID: 12665524
  10. Results describe the crystal structure of the N-terminal 432 residues of the cation-independent mannose 6-phosphate receptor, which encompass three out of the 15 repetitive domains of its extracytoplasmic region. PMID: 15085180
  11. crystal structure of the N-terminal 432 residues reveals the unique architecture of binding pocket and provides insight into recognition of a variety of mannose-containing sugars PMID: 15169779
  12. CI-MPR contains a third Man-6-P recognition site that is located in domain 5 and that exhibits lower affinity than the carbohydrate-binding sites present in domains 1-3 and 9 PMID: 15252023
  13. The methylation at Igf-2r imprinting control region showed significant variation in tissues, such as blood, liver, brain, heart and heart, and suggested that Igf-2r imprinting was tissue-specifically regulated. PMID: 17150312
  14. The role of insulin-like growth factor 2 (IGF2) and the regulation of the IGF2 receptor (IGF2R) during follicular development were studied. PMID: 17360960
  15. Placental expression of IGF-IIR mRNA was greater for Nuclear transfer-derived than in vivo-derived embryos. PMID: 17628655
  16. study to assess the mRNA expression of IGF-I, IGF-II, IGF-IR and IGF-IIR in bovine oocytes and different stages of preimplantation embryos PMID: 19013732
  17. Variable pattern of IGF2R allelic expression in major organs such as the brain, cotyledon, heart, liver, lung, spleen, kidney and intercotyledon was observed using a G/A transition in the 3'UTR of IGF2R PMID: 19217227

Show More

Hide All

Subcellular Location
Golgi apparatus membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein.
Protein Families
MRL1/IGF2R family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*