Recombinant Human 14-3-3 protein sigma (SFN)

In Stock
Code CSB-EP021135HUb1
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
(Epithelial cell marker protein 1)(Stratifin)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-248aa
Target Protein Sequence
MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
32.8 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway. May also regulate MDM2 autoubiquitination and degradation and thereby activate p53/TP53.; p53-regulated inhibitor of G2/M progression.
Gene References into Functions
  1. Over-expressed and hypo-methylated SFN gene is associated with hepatocellular carcinoma. PMID: 27760737
  2. Review/Meta-analysis: 14-3-3 sigma promoter methylation may be associated with the carcinogenesis of breast cancer and might represent a useful blood-based biomarker for the clinical diagnosis of breast cancer. PMID: 27999208
  3. 14-3-3sigma has a paracrine effect in educating stromal cells in tumor-associated microenvironment. PMID: 27175590
  4. This data indicates that 14-3-3sigma contributes to P-gp overexpression through interaction with PXR with rifampin and paclitaxel treatment. PMID: 28077325
  5. The impact of AKT1 on glucocorticoid receptor (GR)-induced transcriptional activity in cooperation with phospho-serine/threonine-binding protein 14-3-3, was examined. PMID: 27717743
  6. Data showed that 14-3-3s contributed to ionizing radiation (IR) resistance possibly by regulating cell cycle progression and non-homologous end joining repair of IR-induced DNA double strand breaks via regulating the expression of Chk2 and PARP1. These findings suggest that 14-3-3s may be an upstream master regulator in chemo and radiation resistance and cancer cell survival. PMID: 28087741
  7. Structural basis for the interaction of a human HSPB6 protein with the 14-3-3 universal signaling regulator has been reported. PMID: 28089448
  8. Dual co-expression of human fetal Tau with PKA in Escherichia coli results in multisite Tau phosphorylation including also naturally occurring sites which were not previously considered in the context of 14-3-3 binding. Tau protein co-expressed with PKA displays tight functional interaction with 14-3-3 isoforms of a different type. PMID: 28575131
  9. Data suggest that 14-3-3 sigma protein exhibits two individual secondary binding sites for peptide fragments of TAZ protein; these two pockets appear to be part of at least three physiologically relevant and structurally characterized 14-3-3 protein-protein interaction interfaces. PMID: 28681606
  10. These results suggest that SFN facilitates lung tumor development and progression. SFN appears to be a novel oncogene with potential as a therapeutic target PMID: 26223682
  11. SFN regulates cancer metabolic reprogramming. It opposes tumor-promoting metabolic programs by enhancing c-Myc poly-ubiquitination and degradation. SFN suppresses cancer glycolysis, glutaminolysis, and mitochondrial biogenesis. PMID: 26179207
  12. Data show that overexpression of the 14-3-3sigma isoform resulted in a disruption of the tubulin cytoskeleton mediated by binding Tau protein. PMID: 26103986
  13. K17 expression is accompanied by cytoplasmic expression of 14-3-3 sigma, indicative of their functional relationship in oral squamous cell carcinoma PMID: 25736868
  14. SFN affects the water-holding capacity, barrier function and dermal matrix components in photoaging skin. An increase of SFN triggered by UVB irradiation may be one of the causes of alterations observed in photoaging skin. PMID: 25234834
  15. Results suggest a role of Wig-1 as a survival factor that directs the p53 stress response toward cell cycle arrest rather than apoptosis through the regulation of FAS and 14-3-3sigma mRNA levels. PMID: 24469038
  16. 14-3-3sigma alone or combined with HSP70 are potential prognostic biomarkers for HCC PMID: 24923353
  17. Decreased expression of immunoreactive 14-3-3sigma may be a predictor of poor prognosis in patients with uterine papillary serous carcinoma. PMID: 24201220
  18. Cdc25B upregulation and 14-3-3sigma downregulation might promote development of bladder cancer and suggested a poor prognosis. PMID: 24234332
  19. Studied differential protein expression of an anoikis-resistant CCA cell line culture, under attachment and nonattachment conditions. Data reveal 14-3-3sigma protein was intensely upregulated in detached CCA cells. PMID: 24030981
  20. stratifin plays a role in regulating plakophilin-3 incorporation into the desmosomal plaque by forming a plakophilin-3 stratifin complex in the cytosol and thereby affecting desmosome dynamics in squamous epithelial cells. PMID: 24124604
  21. this study identified the p53 regulated tumor suppressor 14-3-3sigma as a direct plakoglobin-p53 target gene. PMID: 23687381
  22. 14-3-3 sigma is expressed in ovarian granulosa cell tumors and steroid cell tumors, but it is not expressed in ovarian fibromas, thecomas, Sertoli cell tumors, endometrial stromal sarcomas, and sex-cord stromal tumors, unclassified PMID: 23370648
  23. study concludes that LMP-1 may induce cell cycle arrest at G(2)/M progression via upregulation of 14-3-3sigma and Reprimo PMID: 23312294
  24. Crystallographic determination of 14-3-3-sigma binding sites in the human peptidylarginine deiminase type VI. PMID: 22634725
  25. Data suggest that down-regulation of 14-3-3 sigma plays a role in tumorigenesis in myometrium leading to leiomyoma; this mechanism may involve up-regulation of progesterone receptor and estrogen receptors. PMID: 22329840
  26. Data define the subcellular localization and regulation of COP1 after DNA damage and provide a mechanistic explanation for the notion that 14-3-3sigma's impact on the inhibition of p53 E3 ligases is an important step for p53 stabilization after DNA damage. PMID: 20843328
  27. 14-3-3sigma expression is significantly associated with resistance to paclitaxel followed by 5-FU, epirubicin and cyclophosphamide, and this association is independent of other biological markers PMID: 22315133
  28. Data show that SFN and SPARC form a complex thereby controlling the type I collagen synthesis and expression in fibroblasts. PMID: 22422640
  29. down-regulation of 14-3-3sigma in the absence of CCDC6 demonstrated their direct association and supports the notion that CCDC6 contributes to cancer development, possibly through malignant pathways involving 14-3-3sigma PMID: 22399611
  30. Multivariate analyses revealed that 14-3-3o expression was an independent prognostic parameter in gastric cancer. PMID: 21933426
  31. 14-3-3sigma-mediated molecular events that synergise with p53 may play important roles in the chemotherapy of breast cancer. PMID: 22192357
  32. Epstein-Barr virus Rta-mediated transactivation of p21 and 14-3-3sigma arrests cells at the G1/S transition by reducing cyclin E/CDK2 activity. PMID: 21918011
  33. role of hydrophobic residues at the dimeric interfac PMID: 21870863
  34. data suggest that the CSN6-COP1 axis is involved in 14-3-3sigma degradation, and that deregulation of this axis will promote cell growth and tumorigenicity PMID: 21625211
  35. Hypomethylation of the 14-3-3sigma promoter leads to increased expression in non-small cell lung cancer. PMID: 21755566
  36. Data indicate that gene analysis revealed an up-regulation of all four 14-3-3 isoforms beta, eta, gamma, and sigma. PMID: 21416292
  37. 14-3-3sigma controls the in vivo epidermal proliferation-differentiation switch by reducing proliferative potential and forcing keratinocytes to exit the cell cycle, and that this effect associates with inhibition of the IGF-1 pathway. PMID: 21654836
  38. found that metastatic ovarian tumors frequently overexpress 14-3-3 sigma PMID: 21249227
  39. Transient down-regulation of 14-3-3 Sigma promotes maintenance of the p63-positive population without affecting normal differentiation. PMID: 21239874
  40. 14-3-3sigma protein likely contributes to the poor clinical outcome of human pancreatic cancers by causing resistance to radiation and anticancer drugs PMID: 21040574
  41. 14-3-3sigma has been cloned, purified and crystallized in complex with a phosphopeptide from the YAP 14-3-3-binding domain, which led to a crystal that diffracted to 1.15 A resolution. PMID: 20823509
  42. up-regulation of 14-3-3 sigma protein is associated with scirrhous-type gastric carcinoma. PMID: 21115893
  43. low expression of 14-3-3sigma appears to be a valuable marker for better survival in patient with undifferentiated nasopharyngeal carcinoma PMID: 20811675
  44. 14-3-3 sigma promoter hypermethylation can contribute to reducing or losing expression of this protein which plays an important role in the development of sporadic breast carcinomas & is involved in various types, grades, & lymphatic metastases. PMID: 19685192
  45. The favorable OS for MF-CCA patients depends on the absence of clinical symptoms, negative lymph node metastasis, and curative hepatectomy. PMID: 20976731
  46. downregulation of 14-3-3sigma protein was significantly associated with proliferation, invasion depth and lymph node metastasis of ESCC. Statistically significant correlations between expression of beta-catenin and 14-3-3sigma. PMID: 19664078
  47. Indicate that stratifin could be a useful indicator for prognosis of esophageal squamous cell carcinoma, as well as a potential target for more effective therapy. PMID: 20108042
  48. 14-3-3 eta, beta, gamma and sigma isoforms were negatively expressed in meningioma PMID: 20388496
  49. The relationship of 14-3-3-sigma with breast cancer metastasis and progression found in this study suggests a possible application of 14-3-3-sigma as a biomarker to screen for metastasis and treatment response. PMID: 20487521
  50. The abnormal expression of 14-3-3 sigma and HSP27 is significantly associated with lymph node metastasis in colorectal cancer. PMID: 20336542

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Secreted. Note=May be secreted by a non-classical secretory pathway.
Protein Families
14-3-3 family
Tissue Specificity
Present mainly in tissues enriched in stratified squamous keratinizing epithelium.
Database Links

HGNC: 10773

OMIM: 601290

KEGG: hsa:2810

STRING: 9606.ENSP00000340989

UniGene: Hs.523718

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*