Recombinant Human Agouti-related protein (AGRP), partial

Code CSB-RP056944h
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
Agouti related neuropeptide; Agouti Related Protein Homolog; Agouti-related protein; Agrp; AGRP_HUMAN; AGRT; ART; ASIP2
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
83-132aa
Target Protein Sequence
SSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
32.7kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in weight homeostasis. Involved in the control of feeding behavior through the central melanocortin system. Acts as alpha melanocyte-stimulating hormone antagonist by inhibiting cAMP production mediated by stimulation of melanocortin receptors within the hypothalamus and adrenal gland. Has very low activity with MC5R. Is an inverse agonist for MC3R and MC4R being able to suppress their constitutive activity. It promotes MC3R and MC4R endocytosis in an arrestin-dependent manner.
Gene References into Functions
  1. AgRP is not associated with changes in hunger or satiety, and can change without corresponding changes in leptin. This suggests that AgRP may not be involved in the episodic control of appetite and the release of AgRP may involve signals other than leptin. PMID: 27476955
  2. data provide compelling evidence that AgRP is a heparan sulfate-binding protein and localizes critical regions in the AgRP structure required for this interaction. PMID: 28264929
  3. The aim of this survey is to evaluate the association of genetic variants of melanocortin-4-receptor (MC4R), pro-opiomelanocortin (POMC), apolipoprotein E (APOE) and agouti-related protein (AGRP) with obesity in the North Indian population. PMID: 26226973
  4. CSF AgRP was not different in lean vs. overweight/obese subjects; however, plasma AgRP was higher in lean subjects. PMID: 26152765
  5. human agouti-related protein has a role in enhancing expression and stability of human melanocortin-4 receptor PMID: 25446108
  6. Variations in genes AGRP, CPE, GHRL, GLP1R, HTR2A, NPY1R, NPY5R, SOCS3 and STAT3 showed modest associations with BMI in European Americans. PMID: 23900445
  7. Elevations in AgRP also favor the diagnosis of ectopic ACTH syndrome, suggesting AgRP should be further evaluated as a potential neuroendocrine tumor marker. PMID: 25013995
  8. AGRP SNP (rs1338993) was not associated with antipsychotic-induced weight gain in schizophrenia patients. PMID: 24564533
  9. Data suggest that prolonged steady-state exercise/physical activity at moderate intensity elicits substantial increases in blood lactate and cortisol concentrations without a significant change in AgRP; study was pilot project involving men. PMID: 22477065
  10. Despite peripheral hyperleptinemia, positive energy balance is achieved during pregnancy by a relative decrease in central leptin concentrations and resistance to leptin's effects on target neuropeptides that regulate energy balance. PMID: 23118421
  11. AgRP and NPY are correlated with body weight changes, rather than the presence of type 2 diabetes, whereas changes in alphaMSH immunoreactivity are related to the presence of type 2 diabetes, indicating separate hypothalamic mechanisms. PMID: 22492775
  12. Cognitive flexibility plays an important role in anorexia nervosa and may be modulated by abnormal levels of the appetite-regulating peptide AGRP. PMID: 21531082
  13. This review defines how peripheral signals (particularly leptin, insulin and glucose) converge on a molecular level in proopiomelanocortin (POMC)- and agouti-related protein (AgRP)-expressing arcuate nucleus neurons to control energy homeostasis. PMID: 19770186
  14. Only the patients with nonalcoholic fatty liver presented a positive correlation between the saturated fatty acids intake and the orexigenic neuropeptides NPY and agouti related protein, and carbohydrate with NPY PMID: 20164781
  15. AgRP may provide an important signal in the immune environment and the lymphocyte may be considered as an extra-hypothalamic source of plasma AgRP following exercise stress PMID: 20404050
  16. Agouti-related protein is neatively correlated with nonalcolic fatty liver disease in obese adolescents. PMID: 19942238
  17. A polymorphism, 199G>A, resulted in substitution of the amino acid at position 67 from alanine to threonine. PMID: 11602360
  18. NMR structural studies show that the loop in the first 16 residues of the C-terminal domain of AGRP confers distinct selectivity for melanocortin receptors MC3R and MC4R. PMID: 11747427
  19. the c.199G-->A polymorphism in hAGRP could play a role in the development of human obesity in an age-dependent fashion PMID: 12213871
  20. Ala67Thr polymorphism in the Agouti-related peptide gene is associated with inherited leanness in humans PMID: 15054840
  21. Two single nucleotide polymorphisms in the AGRP promotor showed opposite effects on promotor activity. PMID: 15121772
  22. Serum levels could serve as useful peripheral markers of changes in energy homeostasis. PMID: 15546902
  23. the C-terminus of AgRP can participate in the insulin secretion in pancreatic beta cells, through the modulation of calcium release PMID: 15978665
  24. Single-nucleotide polymorphisms found in anorexia nervosa. PMID: 16314751
  25. AgRP may have a novel inhibitory paracrine role in the human adrenal gland PMID: 16320160
  26. analysis of molecular basis of melanocortin-4 receptor for AGRP inverse agonism PMID: 16820227
  27. Plasma Agouti-related protein (AGRP)elevation may be related to energy homeostasis disturbance in anorexia nervosa, and in addition to leptin, peripheral AGRP levels could be used as a nutritional marker in AN patients. PMID: 16904835
  28. in addition to its inverse agonistic activities, Agrp exhibits agonistic properties on the endocytosis pathway of melanocortin-3 and -4 receptors PMID: 17041250
  29. a rare mutation, +79G>A, was identified in the AGRP minimal promoter; the +79G>A mutation could predispose to body weight gain PMID: 17180153
  30. two adjacent enhancers inside the first intron of the neighboring (1.4 kb downstream) ATPase gene (ATP6V0D1) modulate the human AgRP promoter with profound spatiotemporal variation PMID: 19285986
  31. This study presents an association of rare allele of AGRP polymorphism in heterozygous state with increased body mass index PMID: 19602223
  32. The high expressing C/C genotype of AGRP was significantly associated with high BMI and type 2 diabetes in Africans. PMID: 11554767

Show More

Hide All

Involvement in disease
Obesity (OBESITY)
Subcellular Location
Secreted. Golgi apparatus lumen.
Tissue Specificity
Expressed primarily in the adrenal gland, subthalamic nucleus, and hypothalamus, with a lower level of expression occurring in testis, lung, and kidney.
Database Links

HGNC: 330

OMIM: 601665

KEGG: hsa:181

STRING: 9606.ENSP00000290953

UniGene: Hs.104633

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*