Recombinant Human Aldehyde oxidase (AOX1), partial

In Stock
Code CSB-EP001858HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Metabolism
Alternative Names
AOX1; AOAldehyde oxidase; EC 1.2.3.1; Aldehyde oxidase 1; Azaheterocycle hydroxylase; EC 1.17.3.-
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
236-421aa
Target Protein Sequence
FGSERMMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILADVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKCPNADLKPQEILVSVNIPYSRK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
24.6kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Can you please provide the following:
1)For catalog: CSB-EP001858HU (all expression systems):
a.Has the tag been removed successfully for any expression systems? If yes, which ones?; b.Do you have any metabolism studies related data? Or knowledge on using this protein in metabolism studies? What co-factors are involved? What positive control can I use? (I don’t expect you to know this Vivian but thought I’d ask just in case you may.)
2)I am also looking for the following isoforms you may have, 2,3,4,etc. :
a.Recombinant Human Aldehyde oxidase 2 (full-length); b.Recombinant Human Aldehyde oxidase 3 (full-length); c.Recombinant Human Aldehyde oxidase 4 (full-length)
If you have these proteins, can you please also provide the same information requested above for AO a.Sequence; b.Tag type; c.Tag position; d.Sizes and formats; e.Has the tag been removed successfully for any expression systems? If yes, which ones?; f.Do you have any metabolism studies related data?...

A:
Thanks for your inquiry.
Recombinant human Aldehyde oxidase(AOX1)
CSB-YP001858HU >> Yeast
CSB-EP001858HU >> E.coli
CSB-BP001858HU >> Baculovirus
CSB-MP001858HU >> Mammalian cell
Sorry, we have never removed the tag of this protein before, We can try enzyme digestion, but we can't guarantee 100% successfully.
The overall success rate of enzyme digestion data analysis is 75%-86%, but we should explaing to you in advance:
Not all protein tags can be removed as some proteins will be very unstable after tag removal.
If we succeed in removing the tag, we will charge for extra cost.
If we fail in removing the tag, we won’t charge for tag removal and provide the fusion protein, and remark this information in datasheet as follows “Note: The laboratory determined that the Tag on your protein could not be removed with standard laboratory procedures. Your protein is being supplied with the Tag intact.”
Generally, the delivery time will be extended for 3 days.
Please refer to the following link, it have the information of the metabolism studies: http://dmd.aspetjournals.org/content/38/8/1322.long
About the Aldehyde oxidase, the human species only express AOX1, so we don't have 2,3,4.

Target Background

Function
Oxidase with broad substrate specificity, oxidizing aromatic azaheterocycles, such as N1-methylnicotinamide, N-methylphthalazinium and phthalazine, as well as aldehydes, such as benzaldehyde, retinal, pyridoxal, and vanillin. Plays a key role in the metabolism of xenobiotics and drugs containing aromatic azaheterocyclic substituents. Participates in the bioactivation of prodrugs such as famciclovir, catalyzing the oxidation step from 6-deoxypenciclovir to penciclovir, which is a potent antiviral agent. Is probably involved in the regulation of reactive oxygen species homeostasis. May be a prominent source of superoxide generation via the one-electron reduction of molecular oxygen. Also may catalyze nitric oxide (NO) production via the reduction of nitrite to NO with NADH or aldehyde as electron donor. May play a role in adipogenesis.
Gene References into Functions
  1. AOX1 SNPs exist in which the base-pair exchange of the SNP leads to loss of enzyme activity. PMID: 26842593
  2. ten novel single nucleotide polymorphisms resulting in amino acid exchanges in proximity to the FAD site of hAOX1, were characterized. PMID: 28750088
  3. Data suggest that substrate specificity of AOX1 includes GDC-0834, an inhibitor of Bruton's tyrosine kinase with potential non-steroidal anti-inflammatory agent activity; in liver cytosol, hydrolysis of GDC-0834 is primarily due to AOX1. PMID: 25845827
  4. Methotrexate is poorly metabolized by human AOX1, in contrast to rabbit. PMID: 26032640
  5. These results supported the possibility that XO/XD and AO can contribute to nitric oxide generation. PMID: 25537183
  6. Several donors have a normal AOX1 protein level. PMID: 23857892
  7. High AOX1 methylation was associated with biochemical recurrence in prostate cancer. PMID: 23918943
  8. The physiological role of AOX1 remains unclear, but it is known that thiopurines belong to its substrates; AOX1 contributes to azathioprine catabolism. PMID: 22495427
  9. hydralazine, at a concentration of 25 to 50 muM, can be used in human hepatocyte incubations to estimate the contribution of aldehyde oxidase to the hepatic clearance of drugs and other compounds. PMID: 22522748
  10. Human population is characterized by the presence of functionally inactive hAOX1 allelic variants as well as variants encoding enzymes with different catalytic activities. PMID: 22279051
  11. characterization of AO activity in cryopreserved human hepatocytes: enzyme stability; substrate specificity; kinetics; inhibition by hydralazine PMID: 22031625
  12. Expressed AOX1 in Escherichia coli and purified kinetically active protein. PMID: 19741035

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Xanthine dehydrogenase family
Tissue Specificity
Abundant in liver, expressed in adipose tissue and at lower levels in lung, skeletal muscle, pancreas. In contrast to mice, no significant gender difference in AOX1 expression level (at protein level).
Database Links

HGNC: 553

OMIM: 602841

KEGG: hsa:316

STRING: 9606.ENSP00000363832

UniGene: Hs.406238

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*