Recombinant Human Bcl-2-like protein 11 (BCL2L11)

Code CSB-YP002615HU
MSDS
Size $250
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
BCL2 like 11 ; B2L11_HUMAN; BAM; Bcl 2 interacting protein Bim; Bcl 2 related ovarian death agonist; Bcl-2-like protein 11; BCL2 interacting mediator of cell death ; BCL2 like 11 (apoptosis facilitator); BCL2 like protein 11 ; Bcl2-interacting mediator of cell death; Bcl2-L-11; Bcl2l11; BIM alpha6; BIM; BIM beta6; BIM beta7; BimEL; BimL; BOD
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-198aa
Target Protein Sequence
MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
24.2kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Induces apoptosis and anoikis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than isoform BimEL, isoform BimL and isoform BimS. Isoform Bim-gamma induces apoptosis. Isoform Bim-alpha3 induces apoptosis possibly through a caspase-mediated pathway. Isoform BimAC and isoform BimABC lack the ability to induce apoptosis.
Gene References into Functions
  1. POH1 knockdown induced cell apoptosis through increased expression of p53 and Bim. PMID: 29573636
  2. BIM deletion polymorphism was associated with significantly shorter progression-free survival (PFS) and slightly shorter overall survival (OS), compared to the WT group. Moreover, patients with BIM deletion polymorphism showed significantly inferior response to EGFR TKIs. In conclusion, our analysis confirmed that lung cancer patients harboring the BIM deletion have inferior survival and TKI responses. PMID: 30213299
  3. Our findings suggest that miR-23 plays a crucial role in controlling VSMCs proliferation and apoptosis by targeting BCL2L11 PMID: 30249504
  4. FoxO3a overexpression increased the transcription and protein expression of Bcl2like protein 11 and cyclindependent kinase inhibitor 1B, and inhibited cyclin D1 transcription and expression. PMID: 29257235
  5. Data indicate that miR-34a enhanced the sensitivity to cisplatin by upregulation of c-Myc and Bim pathway. PMID: 29060932
  6. Modulation of MEK/ERK-dependent Bim and Mcl-1 degradation critically mediates sensitivity and resistance of EGFR-mutant non-small cell lung cancer (NSCLC)cells to AZD9291 and hence is an effective strategy to overcome acquired resistance to AZD9291 PMID: 28765329
  7. TMEM16A expression was found to correlate with greater tumor size, less Bim expression, and less apoptotic activity overall in head and neck squamous cell carcinomas (HNSCCs). PMID: 28899969
  8. Hypermethylation of the proapoptotic genes BCL2 L11 and TNFRSF25 is observed in pleomorphic adenoma of the salivary glands. However, this phenomenon did not impact mRNA transcription. PMID: 28941993
  9. Data suggest that regulation of pancreatic beta-cell function and survival/apoptosis involves alternative splicing modulated by key splicing regulator SRP55; SRP55-regulated alternative splicing includes modulation of function of pro-apoptotic proteins (BIM, BAX), JNK signaling, and endoplasmic reticulum stress. (SRP55 = pre-mRNA-splicing factor SRP55; BAX = apoptosis regulator BAX) PMID: 29246973
  10. Bim expression was significantly different in the four molecular subtypes of breast cancer. PMID: 28582840
  11. BIM deletion is a significant predictor of shorter PFS and OS on EGFR-TKIs. Further studies to determine its effect on response to other BIM-dependent therapeutic agents are needed, so that alternative treatment strategies may be devised. PMID: 28467813
  12. These findings indicate the importance of developing HDAC3-selective inhibitors, and their combined use with osimertinib, for treating EGFR-mutated lung cancers carrying the BIM deletion polymorphism PMID: 27986747
  13. Low BIM expression is associated with renal cell carcinoma. PMID: 27582546
  14. The decreased miR-101-3p caused elevated Bim expression by targeting its 3'-untranslated region (3'-UTR). PMID: 28518140
  15. The mitochondrial apoptotic pathway, activated by BH3-only proteins, BIM and PUMA, is essential for endoplasmic reticulum stress-induced cell death; DR5 as well as caspase-8 are not required for this process. PMID: 28409774
  16. sequestration of Bim by Mcl-1 is a mechanism of intrinsic ABT-199 resistance and supports the clinical development of ABT-199 in combination with cytarabine or daunorubicin for the treatment of AML. PMID: 27103402
  17. Knock down of VDR and BIM reduces the enhancement of cell death treated with Cytarabine (AraC) followed by the addition of Doxercalciferol together with Carnosic acid (CA). PMID: 27144333
  18. UMI-77 enhances TRAIL-induced apoptosis by unsequestering Bim and Bak, which provides a novel therapeutic strategy for the treatment of gliomas. PMID: 28337703
  19. Conversion of Bim-BH3 from Activator to Inhibitor of Bak through Structure-Based Design. PMID: 29149594
  20. in FOXO3-death-resistant cells no point mutations in the TP53-DBD were found-in these cells FOXO3-TP53 complexes are formed and FOXO3-binding to the BIM-promoter, but not the induction of the detoxifying protein SESN3, were prevented, which in turn increased chemo-protection in this type of high-stage-derived neuroblastoma cells PMID: 28869600
  21. At BCL2L11, the authors identify a haematopoietic enhancer hub that is inactivated by the Epstein-Barr virus repressors EBNA3A and EBNA3C through recruitment of the H3K27 methyltransferase EZH2. PMID: 27490482
  22. observations suggest that an association of a deletion polymorphism of BIM and the response to induction therapy in B-cell precursor acute lymphoblastic leukemia may be clinically minimal PMID: 28641145
  23. expression of Bim is mediated by FoxO1 and indirectly downregulated by thyroid hormone/thyroid hormone receptor, leading to chemotherapy resistance and doxorubicin-promoted metastasis of hepatoma cells. PMID: 27490929
  24. BIM is associated with favorable prognostic markers for prediction of disease-free survival and overall survival in cervical cancer. PMID: 28870908
  25. this study shows that BIM deletion polymorphisms are associated with a poor clinical response to erlotinib and represents an independent prognostic factor for patients with EGFR positive non-small-cell lung cancer PMID: 27926478
  26. The Bim deletion polymorphism was found to be associated with primary resistance to crizotinib in patients with ALK fusion-positive NSCLC. PMID: 28346673
  27. increased apoptosis resistance was associated with significantly reduced up-regulation of proapoptotic Bim in T cells from patients with primary sclerosing cholangitis. PMID: 27630216
  28. Results suggest that valproic acid (VPA) reduces paraoxonase 2 (PON2) expression in glioblastoma multiforme (GBM) cells, which in turn increases reactive oxygen species (ROS) production and induces Bim protein production that inhibits cancer progression via the PON2-Bim cascade. PMID: 28108734
  29. Little difference in Bim expression among CD20+ cells was seen between tonsil primary follicles, tonsil germinal centers, and lupus nephritis renal tissue. The frequency of Bim-positive cells among CD4+ lymphocytes was significantly lower in lupus nephritis kidneys compared to tonsil controls. PMID: 27159593
  30. Inhibition of mTORC1-mediated 4EBP1 phosphorylation leads to decreased expression of c-MYC and subsequent upregulation of the proapoptotic BCL2 family member PUMA, whereas inhibition of mTORC2 results in nuclear factor-kappaB-mediated expression of the Early Growth Response 1 (EGR1) gene, which encodes a transcription factor that binds and transactivates the proapoptotic BCL2L11 locus encoding BIM. PMID: 26917778
  31. miR-423-3p activates oncogenic and Beclin-1-dependent autophagy and promotes GC progression by reducing the expression of Bim. The newly identified miR-423-3p-Bim axis might be a potential therapeutic target in GC. PMID: 28254439
  32. activation of the PI3K pathway does not suppress activation of the ARF or BIM gene by over-expressed E2F1 PMID: 27888102
  33. have shown that Bim protein expression in CM is an independent predictor for advanced disease confirming that this pro-apoptotic BH3-only protein might be a potent biomarker and promising therapeutic target PMID: 27356803
  34. BIM deletion polymorphism does not account for intrinsic resistance to EGFR-TKI in Patients With Lung Adenocarcinoma PMID: 27077907
  35. Mechanistically, G-Rg1 promoted the phosphorylation of Akt and FoxO3a and led to the cytoplasmic translocation of FoxO3a, which in turn suppressed FoxO3a-modulated expression of proapoptotic Bim and elevated the ratio of Bcl-2 to Bax. PMID: 27522666
  36. Dnd1 facilitates apoptosis by increasing the expression of Bim via its competitive combining with miR-221 in Bim-3'UTR. PMID: 28191469
  37. patients with BIM-g had significantly shorter progression-free survival than those without BIM-gamma (median: 304 vs. 732 days; p=0.023). CONCLUSION: Expression of BIM-gamma mRNA and BIM deletion polymorphism were strongly associated. BIM-gamma overexpression may have a role in apoptosis related to EGFR-tyrosine kinase inhibitor PMID: 27807070
  38. MicroRNA-301b directly targets the expression of Bim, a well-known pro-apoptotic protein. PMID: 27352910
  39. FOXO4 has an inhibitory effect in clearcell renal carcinoma cells, at least in part through inducing apoptosis via upregulation of Bim in the mitochondria-dependent pathway. PMID: 26780985
  40. Results indicate that upregulation of miR-124 could regulate apoptosis and impaired autophagy process in the MPTP model of Parkinson's disease, thus reducing the loss of dopaminergic neurons PMID: 25976060
  41. the Bim activated by doxorubicin-induced DNA damage might directly interrupt the interaction of Bcl-xl with pro-apoptotic proteins, Bak/Bax, to activate mitochondriadriven apoptosis. PMID: 26694174
  42. the BIM deletion polymorphism enhanced the emergence of populations with complete imatinib resistance, mimicking the situation in patients. PMID: 26517680
  43. BimEL-Bax pro-apoptotic cascade is activated by cAMP signalling of Bordetella adenylate cyclase toxin through SHP-1 phosphatase in phagocytes. PMID: 26334669
  44. miR-24 was found to be up-regulated while the expression of BCL2L11 was inhibited in tumor tissues of gastric cancer PMID: 26758252
  45. The potent antitumor activity of RHL may be mediated through downregulation of Bcl-2 and cyclin D expression and upregulation of BAX and Bim expression. PMID: 26707131
  46. mRNA expression of BIM and MTOR in 57 patients with EGFR-mutant non-small-cell lung cancer. PMID: 26639561
  47. miR-24 promotes tumor growth and angiogenesis by suppressing Bim expression in a model of pancreatic carcinoma PMID: 26517093
  48. miR-181b/Bim pathway may be a novel target used to overcome the chemoresistance in breast cancer PMID: 26572075
  49. Bcl-2 dependent NB cell lines are exquisitely sensitive to ABT-199 . Treatment with ABT-199 displaces Bim from Bcl-2 in NB to activate caspase 3, confirming the restoration of mitochondrial apoptosis PMID: 26874859
  50. Fluorizoline bind to prohibitin, inducing mitochondrial apoptotic pathway through NOXA and BIM upregulation. PMID: 26497683

Show More

Hide All

Subcellular Location
Endomembrane system; Peripheral membrane protein.; [Isoform BimEL]: Mitochondrion. Note=Translocates from microtubules to mitochondria on loss of cell adherence.; [Isoform BimL]: Mitochondrion.; [Isoform BimS]: Mitochondrion.; [Isoform Bim-alpha1]: Mitochondrion.
Protein Families
Bcl-2 family
Tissue Specificity
Isoform BimEL, isoform BimL and isoform BimS are the predominant isoforms and are widely expressed with tissue-specific variation. Isoform Bim-gamma is most abundantly expressed in small intestine and colon, and in lower levels in spleen, prostate, testis
Database Links

HGNC: 994

OMIM: 603827

KEGG: hsa:10018

STRING: 9606.ENSP00000376943

UniGene: Hs.469658

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*