Recombinant Human Beta-nerve growth factor (NGF)

In Stock
Code CSB-EP015779HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
(Beta-NGF)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
122-241aa
Target Protein Sequence
SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVRRA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
20.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systems. Extracellular ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades to regulate neuronal proliferation, differentiation and survival (Probable). The immature NGF precursor (proNGF) functions as ligand for the heterodimeric receptor formed by SORCS2 and NGFR, and activates cellular signaling cascades that lead to inactivation of RAC1 and/or RAC2, reorganization of the actin cytoskeleton and neuronal growth cone collapse. In contrast to mature NGF, the precursor form (proNGF) promotes neuronal apoptosis (in vitro). Inhibits metalloproteinase-dependent proteolysis of platelet glycoprotein VI. Binds lysophosphatidylinositol and lysophosphatidylserine between the two chains of the homodimer. The lipid-bound form promotes histamine relase from mast cells, contrary to the lipid-free form.
Gene References into Functions
  1. the effects of secretome-enriched conditioned medium (CM) of neuronally differentiated PC12 cells on the neuronal differentiation of human mesenchymal stem cells via NGF like mechanism, is reported. PMID: 29527653
  2. Single nucleotide polymorphisms in NGF gene (rs6330) and NGFR gene (rs2072446 and rs734194) are associated with ischemic stroke. The NGF rs6330*T and NGFR rs2072446*T minor alleles might be nominated as a risk factor for developing ischemic stroke and NGFR rs734194*G minor allele as a protective against this disease at least in Armenian population PMID: 29499660
  3. Neurotrophic factors and hippocampal activity in PTSD PMID: 29799860
  4. SNRPA may contribute to GC progression via NGF and could be a prognostic biomarker for GC. PMID: 30039889
  5. Results show that NGF signalling is strongly linked to pathological and regenerative processes in human teeth. PMID: 28465581
  6. The results suggest an interaction between NGF, GDNF and MMP-9 during the transition to malignancy in prostate cancer (PC). Also this interaction may involve in regulating PC cell differentiation, tumor invasion, progression, and the agressiveness of PC. PMID: 28237042
  7. the anti-tumor activity of oleuropein against hepatocellular carcinoma could be attributed to influencing the pro-NGF/NGF balance via affecting MMP-7 activity without affecting the gene expression of NGF PMID: 29476769
  8. co-expression patterns of NGF and heme oxygenase-1 might be used as prognostic indicators for gastric carcinoma patients PMID: 28679437
  9. This review will briefly address the peripheral and central sensitization mechanisms of airway neurons and will then focus on NGF signaling and its role in cough hypersensitivity.[review] PMID: 28494216
  10. First-trimester plasma nerve growth factor is lower in patients who subsequently develop preeclampsia. PMID: 27513943
  11. This study show evidence of variation in plasmatic beta-NGF expression during the progression of dementia. PMID: 27802234
  12. NGF is functionally linked to beta-catenin, promoting the migration of human ovarian cancer cells via the WNT/beta-catenin pathway. PMID: 27835587
  13. Varicella zoster virus DNA replication is regulated in part by an NGF pathway that is PI3-kinase-independent. PMID: 27683235
  14. Many studies indicate that the only presence of NGF is unable to generate cell carcinogenesis, both in normal neuronal and non-neuronal cells/tissues. However, it cannot be excluded the possibility that the co-expression of NGF and pro-carcinogenic molecules might open to different consequence. [review] PMID: 27439311
  15. the effect and underlying mechanisms of NGF/BDNF on the production of NPW in PC12 cells and hypothalamus, is reported. PMID: 28249734
  16. These data support a role for islet NGF in fine-tuning insulin secretion. PMID: 27424144
  17. The results of this study indicated that dysmenorrhea pain severity is partly genetically determined by the chromosome 1p13.2, near the nerve growth factor locu. PMID: 27454463
  18. Findings suggest that IL-1beta and TNF-alpha regulate Nerve Growth Factor expression and production in synovial macrophages and fibroblasts in osteoarthritic joints. PMID: 28677145
  19. These results advance our knowledge of the conformational properties of proNGF and NGF and help provide a rationale for the diverse biological effects of NGF and proNGF at the molecular level. PMID: 28798232
  20. The results of this study suggest that proNGF protein levels may augment the diagnostic accuracy of currently used CSF biomarker panels. PMID: 26825093
  21. Neuroimmune-endocrine events may lead to overactivity of sympathetic nervous system that triggers cascade of pathologic conditions in ovary in polycystic ovary syndrome (PCOS). Data suggest women with PCOS exhibit reduction of CRH and NGF; reduction of CRH/NGF may be under influence of sympathetic nervous system and may reflect deficit of neuronal stress-adaptation in PCOS patients. (CRH = corticotropin releasing hormone) PMID: 27908212
  22. The rare nerve growth factor-beta (NGFB) mutation R221W causes a selective loss of thinly myelinated fibers and especially unmyelinated C-fibers. Carriers of this mutation show altered pain sensation. PMID: 27146986
  23. NGF expression was positively correlated with disease severity and visceral hypersensitivity in irritable bowel syndrome patients. PMID: 27862119
  24. a stage-related modulation of beta-NGF and its receptors in the inflammatory process of OA PMID: 28253191
  25. BDNF and NGF serum levels are reduced in the early and moderate glaucoma stages, suggesting the possibility that both factors could be further investigated as potential circulating biomarkers for the early detection of glaucoma. PMID: 28068360
  26. overexpression of ARMS blocked NGF-mediated secretion, without affecting basal secretion, a decrease in ARMS resulted in potentiation. Similar effects were observed with synembryn-B, a protein that interacts directly with ARMS. Downstream of ARMS and synembryn-B are Galphaq and Trio proteins, which modulate the activity of Rac1 in response to NGF PMID: 26966186
  27. Data show that the standardized nerve growth factor (NGF) concentration was negatively correlated with continuous pain, neuropathic pain and total score, and the standardized S100 proteins S100A8/A9 concentration was positively correlated with present pain intensity and continuous pain. PMID: 27936243
  28. Results indicate that NGF inhibited CRT translocation induced by mitoxantrone. NGF effect on CRT translocation could have consequences in immunotherapy, potentially lessening the effectiveness of this type of treatment. PMID: 28260038
  29. NGF stimulates generation of neurons, but not neuronal progenitors from embryonic stem cells and affects the proportion of specific types of neurons in cultures of differentiating embryonic stem cells. PMID: 28364186
  30. NGF attenuates these responses-both in vivo and in vitro. Therefore, NGF therapy may represent a novel approach for the management of diabetic keratopathy. PMID: 27978558
  31. NGF signaling pathway provides a potential target for developing molecularly targeted therapies PMID: 27792755
  32. these data suggest a positive feedback loop through which NGF-mediated upregulation of p75(NTR) can contribute to the chemo-resistance of Triple negative breast cancer cells. PMID: 27577679
  33. Based on these current developments, the present review provides not only a broad overview of the biological effects of NGF-TrkA-p75NTR on cancer cells and their microenvironment, but also explains why NGF and its receptors are going to evoke major interest as promising therapeutic anti-cancer targets in the coming decade. PMID: 27264679
  34. NGF/CD133 might be an effective and potent therapeutic target for pancreatic cancer metastasis, particularly in perineural invasion PMID: 27654574
  35. The analysis of covariance (ANCOVA) indicated that the mean serum GDNF and NTF3 levels of ADHD patients were significantly higher than that of controls. However, serum BDNF and NGF levels did not show any significant differences between groups. PMID: 27561780
  36. All patients had serum neurotrophin (NT-3, BDNF, NGF) concentrations determined. PMID: 27367919
  37. Serum NGF does not differentiate between recurrent acute pancreatitis and chronic pancreatitis. PMID: 27020638
  38. NGF FLIPs TrkA onto the death TRAIL in neuroblastoma cells PMID: 26962689
  39. Major depression patients had similar serum NGF to controls. PMID: 27008247
  40. data demonstrate the involvement and modulation of nerve growth factor and its receptors in chronic obstructive pulmonary disease and in its staging PMID: 26408608
  41. The present study showed that IL-17, in addition to stimulating an inflammatory response, negatively regulates the action of NGF and NGF R in the polar forms of the leprosy. PMID: 26616164
  42. Locally increased estrogen levels and inflammation may cause increased NGF production in the uterus of patients with adenomyosis. PMID: 25519715
  43. The present study is the first to thoroughly assess the enhancement of neural differentiation of bone marrow mesenchymal stem cells following transfection with bFGF and NGF. PMID: 26572749
  44. Data suggest MMP7 (matrix metalloproteinase 7) in follicular fluid cleaves proNGF (pro-nerve growth factor) in ovarian follicle; both MMP7 and proNGF appear to be products of granulosa cells; processing of proNGF to NGF appears to regulate apoptosis. PMID: 26457789
  45. NGF promotes renal fibrosis via TGF-beta1-signaling activation, suggesting that in kidney diseases high NGF serum levels could contribute to worsen renal fibrosis. PMID: 26066770
  46. This study suggests that the circadian rhythm in the esophagus may be important for the mediation of and/or the response to erosive damage in GERD patients. PMID: 26337663
  47. Intratumoral nerve growth factor expression is not associated with perineural invasion in patients with resected extrahepatic cholangiocarcinoma. PMID: 26547754
  48. NGF has a role in modulating trkANGFR/p75NTR in alphaSMA-expressing conjunctival fibroblasts from human ocular cicatricial pemphigoid PMID: 26569118
  49. NGF-induced tyrosine kinase independent TrkA signaling through CD44 is sufficient to maintain tumor aggressiveness in breast cancer PMID: 25840418
  50. Urinary NGF, but not BDNF, levels decreased significantly after hyaluronic acid therapy. PMID: 24614892

Show More

Hide All

Involvement in disease
Neuropathy, hereditary sensory and autonomic, 5 (HSAN5)
Subcellular Location
Secreted. Endosome lumen.
Protein Families
NGF-beta family
Database Links

HGNC: 7808

OMIM: 162030

KEGG: hsa:4803

STRING: 9606.ENSP00000358525

UniGene: Hs.2561

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*