Recombinant Human Collagen alpha-1 (XVII) chain (COL17A1), partial

In Stock
Code CSB-EP891970HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
COL17A1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
COL17A1; BP180; BPAG2Collagen alpha-1(XVII) chain; 180 kDa bullous pemphigoid antigen 2; Bullous pemphigoid antigen 2) [Cleaved into: 120 kDa linear IgA disease antigen; 120 kDa linear IgA dermatosis antigen; Linear IgA disease antigen 1; LAD-1); 97 kDa linear IgA disease antigen; 97 kDa linear IgA bullous dermatosis antigen; 97 kDa LAD antigen; 97-LAD; Linear IgA bullous disease antigen of 97 kDa; LABD97)]
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1253-1497aa
Target Protein Sequence
YLTSPDVRSFIVGPPGPPGPQGPPGDSRLLSTDASHSRGSSSSSHSSSVRRGSSYSSSMSTGGGGAGSLGAGGAFGEAAGDRGPYGTDIGPGGGYGAAAEGGMYAGNGGLLGADFAGDLDYNELAVRVSESMQRQGLLQGMAYTVQGPPGQPGPQGPPGISKVFSAYSNVTADLMDFFQTYGAIQGPPGQKGEMGTPGPKGDRGPAGPPGHPGPPGPRGHKGEKGDKGDQVYAGRRRRRSIAVKP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
28.4kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The gene responsible for the human Collagen alpha-1 (XVII) chain (COL17A1) protein (1253-1497aa) is co-cloned into a plasmid vector with the N-terminal 6xHis-tag gene to obtain recombinant plasmid, which is then transformed into E.coli cells. E.coli cells demonstrating successful uptake of the recombinant plasmid are selected based on their ability to endure a specific antibiotic. The E.coli cells containing the recombinant plasmid are cultured under conditions promoting the expression of the gene of interest. Post-expression, affinity purification is employed to isolate and purify the recombinant human COL17A1 protein from the cell lysate. The resulting recombinant protein is subjected to denaturing SDS-PAGE, allowing for an estimation of its purity, surpassing 90%.

COL17A1, also known as collagen type XVII alpha 1 chain, is a protein anchored in cell membranes, crucial for many biological functions. It forms part of structures called hemidesmosomes, essential for anchoring skin cells to the underlying basement membrane [1][2][3]. COL17A1 helps skin cells called keratinocytes stick to the basement membrane, keeping the skin intact [4]. It's also vital for creating a suitable environment for special skin cells called melanocyte stem cells, important for skin cell renewal, aging, and the development of skin cancer [5][6]. When COL17A1 levels drop, it affects skin balance and can accelerate aging, especially with exposure to sunlight [4][7]. In cancer, COL17A1 is often overproduced, promoting the growth, spread, and resistance to cell death [8]. On the flip side, changes in how the COL17A1 gene is controlled can increase cancer cell invasion [9]. Removing a specific part of the COL17A1 gene can trigger skin inflammation linked to certain immune responses [10]. Mutations in COL17A1 are associated with skin disorders, both inherited and acquired, like junctional epidermolysis bullosa and corneal dystrophies [11]. Scientists are investigating ways to target COL17A1 for therapy in these conditions, such as correcting gene defects to restore normal protein levels.

References:
[1] F. Jönsson, B. Byström, A. Davidson, L. Backman, T. Kellgren, S. Tuftet al., "Mutations in collagen, type xvii, alpha 1 (col17a1) cause epithelial recurrent erosion dystrophy (ered)", Human Mutation, vol. 36, no. 4, p. 463-473, 2015. https://doi.org/10.1002/humu.22764
[2] Y. Xiang, Y. Liu, Y. Yang, Y. Yan, A. Kim, C. Guoet al., "Reduced expression of collagen 17a1 in naturally aged, photoaged, and uv-irradiated human skin in vivo: potential links to epidermal aging", Journal of Cell Communication and Signaling, vol. 16, no. 3, p. 421-432, 2022. https://doi.org/10.1007/s12079-021-00654-y
[3] S. Tanimura, Y. Tadokoro, K. Inomata, N. Bình, W. Nishie, S. Yamazakiet al., "Hair follicle stem cells provide a functional niche for melanocyte stem cells", Cell Stem Cell, vol. 8, no. 2, p. 177-187, 2011. https://doi.org/10.1016/j.stem.2010.11.029
[4] D. Tong, M. Tanaka, H. Eguchi, Y. Okazaki, M. Muramatsu, & T. Arai, "Col17a1 germline variant p.ser1029ala and mucosal malignant melanoma: an autopsy study", Molecular and Clinical Oncology, vol. 16, no. 2, 2021. https://doi.org/10.3892/mco.2021.2465
[5] Z. Xu, "Bazi bushen alleviates skin senescence by orchestrating skin homeostasis in samp6 mice", Journal of Cellular and Molecular Medicine, vol. 27, no. 18, p. 2651-2660, 2023. https://doi.org/10.1111/jcmm.17833
[6] F. Mao, D. Li, Z. Xin, Y. Du, X. Wang, P. Xuet al., "High expression of col17a1 predicts poor prognosis and promotes the tumor progression via nf-κb pathway in pancreatic adenocarcinoma", Journal of Oncology, vol. 2020, p. 1-12, 2020. https://doi.org/10.1155/2020/8868245
[7] P. Thangavelu, T. Krenács, E. Dray, & P. Duijf, "In epithelial cancers, aberrant col17a1 promoter methylation predicts its misexpression and increased invasion", Clinical Epigenetics, vol. 8, no. 1, 2016. https://doi.org/10.1186/s13148-016-0290-6
[8] C. Fu, L. Chen, Y. Cheng, W. Yang, H. Zhu, X. Wuet al., "Identification of immune biomarkers associated with basement membranes in idiopathic pulmonary fibrosis and their pan-cancer analysis", Frontiers in Genetics, vol. 14, 2023. https://doi.org/10.3389/fgene.2023.1114601
[9] K. Tasanen, L. Tunggal, G. Chometon, L. Bruckner‐Tuderman, & M. Aumailley, "Keratinocytes from patients lacking collagen xvii display a migratory phenotype", American Journal of Pathology, vol. 164, no. 6, p. 2027-2038, 2004. https://doi.org/10.1016/s0002-9440(10)63762-5
[10] M. Nomura, Y. Hamasaki, I. Katayama, K. Abe, N. Niikawa, & K. Yoshiura, "Eosinophil infiltration in three patients with generalized atrophic benign epidermolysis bullosa from a japanese family: molecular genetic and immunohistochemical studies", Journal of Human Genetics, vol. 50, no. 9, p. 483-489, 2005. https://doi.org/10.1007/s10038-005-0282-4
[11] M. Ablinger, T. Lettner, N. Friedl, H. Potocki, T. Palmetzhofer, U. Kolleret al., "Personalized development of antisense oligonucleotides for exon skipping restores type xvii collagen expression in junctional epidermolysis bullosa", International Journal of Molecular Sciences, vol. 22, no. 7, p. 3326, 2021. https://doi.org/10.3390/ijms22073326

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role in the integrity of hemidesmosome and the attachment of basal keratinocytes to the underlying basement membrane.; The 120 kDa linear IgA disease antigen is an anchoring filament component involved in dermal-epidermal cohesion. Is the target of linear IgA bullous dermatosis autoantibodies.
Gene References into Functions
  1. Suspension survival mediated by PP2A-STAT3-Col XVII determines tumor initiation and metastasis in cancer stem cells. PMID: 27306323
  2. Bullous pemphigoid patients with the HLA-DQB1*03:01 allele show an increased T-cell avidity to several epitopes of BP180, particularly the BP180-NC16a domain. (Review) PMID: 28101965
  3. C-terminal processing induces dynamic structural changes and neoepitopes for linear IgA dermatosis autoantibodies on COL17 PMID: 28842325
  4. As a consequence of altered maturation and decreased stability of collagen XVII trimers, reduced collagen XVII is incorporated into the cell membrane, resulting in compromised dermal-epidermal adhesion. Taken together, using this genetic model, we provide the first proof that alteration of the coiled-coil structure destabilizes oligomerization and impairs physiological shedding of collagen XVII in vivo. PMID: 28365758
  5. Pathogenicity of autoantibodies targeting COL17 is epitope dependent. PMID: 26827765
  6. The corneal dystrophy mapped to chromosome 10q23-q24 is associated with the c.3156C>T variant in COL17A1. PMID: 27309958
  7. Data suggest that type XVII collagen (COL17) internalization/macropinocytosis by keratinocytes induced by IgG autoantibodies from patients with bullous pemphigoid (BP) is mediated by PKC (protein kinase C) calcium signaling pathway; BP IgG induced overabundant phosphorylation of COL17. PMID: 27775687
  8. we have produced five new versatile monoclonal antibodies against the Col 17 endodomain that are superior to ectodomain antibodies in diagnosing and differentiating between JEB-gen intermed and JEB-loc/carriers PMID: 26334130
  9. Results show that aberrant epigenetic control is a key driver of COL17A1 gene misexpression and tumor cell invasion in a variety of epithelial neoplasm. These findings have significant clinical implications, suggesting that the COL17A1 promoter methylation status can be used to predict patient outcome. PMID: 27891193
  10. Case Report: IgA autoantibodies targeting the NC16A domain rather than the shed ectodomains of COL17 resulted in linear IgA bullous dermatosis in a pregnant woman. PMID: 27786348
  11. ELISA for IgE anti-NC16a is a helpful parameter in the modification of current treatment and the assessment of risk of relapse in bullous pemphigoid. PMID: 25791894
  12. R1303Q in COL17 hampers C-terminal cleavage of COL17. Increase in remnants of non-cleaved COL17 ectodomain in extracellular matrix (ECM) induces aberrant laminin 332 deposition in ECM, which may be associated with disorganized basement membrane formation. PMID: 26604146
  13. The COL17A1 c.3156C-->T variant is the likely causative mutation in our recurrent corneal erosion families, and its presence in 4 independent families suggests that it is prevalent in epithelial recurrent erosion dystrophy. PMID: 26786512
  14. Elevated serum levels of BP180 antibodies in the first trimester of pregnancy precede gestational pemphigoid and remain elevated for a long time after remission of the disease. PMID: 25758329
  15. Letter/Case Report: IgE BP180 antibodies contribute to the occurrence of urticarial erythema in bullous pemphigoid patients. PMID: 25771164
  16. IgE anti-BP180 autoantibody level is increased in some Chinese patients with bullous pemphigoid. PMID: 25797173
  17. The aging process can be recapitulated by Col17a1 deficiency and prevented by the forced maintenance of COL17A1 in hair follicle stem cell (HFSCs), demonstrating that COL17A1 in HFSCs orchestrates the stem cell-centric aging program of the epithelial mini-organ. PMID: 26912707
  18. Our findings implicate presumed gain-of-function COL17A1 mutations causing dominantly inherited ERED and improve understanding of the underlying pathology. PMID: 25676728
  19. Case Reports: two Japanese patients with bullous pemphigoid with only BP230 autoantibodies detected by ELISA. PMID: 24676568
  20. Circulating anti-BP180 autoantibodies are not correlated with severity of genital lichen sclerosis or itching. PMID: 24676719
  21. study reports for the first time the expression of collagen XVII in colon epithelium and the association of increased collagen XVII immunoexpression with poor outcome in colorectal carcinoma. PMID: 25623077
  22. Variants of the PTCH1 and COL17A1 genes may contribute to the development of Ossification of the posterior longitudinal ligament. PMID: 24668667
  23. Lack of C17 led to decreased melanin intensity and melanocyte density in the epidermis when compared with the revertant patches. In human skin, melanocyte supply to the epidermis depends on C17 expression in keratinocytes. PMID: 24330315
  24. Missense mutation R1303Q in COL17a1 causes junctional epidermolysis bullosa phenotype similar to Kindler syndrome. PMID: 24005051
  25. Titers of anti-BP180 autoantibodies were strongly correlated with BPDAI (r = 0.557, P value < 0.0001) and ABSIS (r = 0.570, P value < 0.0001) values. PMID: 23227089
  26. The results of this study suggest that BP180 internalization induced by bullous pemphigoid IgG plays an important role in the initiation of disease pathogenesis. PMID: 23337823
  27. found the full-length collagen XVII protein in proliferating tissue melanocytes, basal keratinocytes and squamous cell carcinoma whereas resting melanocytes were negative PMID: 22688676
  28. Collagen XVII (BP180) modulates keratinocyte expression of the proinflammatory chemokine, IL-8. PMID: 22775995
  29. Collagen XVII has a function in the attachment of podocyte foot processes to the glomerular basement membrane. PMID: 22457199
  30. migrating keratinocytes shed the Ecto-ColXVII, and this dynamically binds via its C-terminal domain to distinct partners in the ECM PMID: 21801871
  31. presence of minor amounts of collagen XVII protein in JEB skin is associated with mild phenotypic manifestations. PMID: 21357940
  32. Cell surface COL17 can interact with laminin 332 and, together, participate in the adherence of a cell to the extracellular matrix. PMID: 21034821
  33. Alterations in type I hemidesmosome components (BP180 and BP230) are suggestive of epigenetic control in the salivary glands of patients with Sjogren's syndrome. PMID: 21305504
  34. small proportion of pregnant women produce protein-specific IgE autoantibodies PMID: 20471095
  35. anti-hBPAG2 IgG was initially directed against extracelllar domain epitopes;humoral responses subsequently targeted additional extra and intracellular domain BPAG2 epitopes PMID: 19812601
  36. Depletion of CD4-positive T cells as well as CD45R-positive B cells in an immunodeficient transgenic mouse model of bullous pemphigoid inhibits production of anti-human COL17 IgG antibodies in the recipients, resulting in no apparent clinical phenotype. PMID: 20089696
  37. The role of collagen XVII in both autoimmune and genetic blistering disorders demonstrates its relevance to dermal-epidermal adhesion PMID: 19945617
  38. We describe a Chinese family with generalized atrophic benign epidermolysis bullosa (GABEB). serine to cysteine at position 265. novel polymorphic substitution of C-to-G at nucleotide position 798 in exon 10 of the COL17A1 gene, an I233M change in BPAG2 PMID: 11912005
  39. this protein, an epithelial adhesion protein, is shed from the cell surface by ADAMs PMID: 12356719
  40. Mutations in the coding sequence of the human collagen XVII (COL17A1) gene are not the cause of Thiel-Behnke Corneal Dystrophy. PMID: 14562173
  41. truncation of the intracellular domain of BP180 impairs the organization of hemidesmosomes, affecting both the mechanical stability of basal keratinocytes and dermoepidermal cohesion. PMID: 14962091
  42. bullous pemphigoid sera reacted with at least an additional antigenic site other than the NC16A, within the extracellular (37%) and intracellular (28%) domains of BP180. PMID: 14962097
  43. genetic variation in COL17A1 shows no association with susceptibility to bullous pemphigoid. PMID: 14987253
  44. Dimished, but correctly localised expression of BP180 in epidermolysis bullosa; COL15 mutated BP180 is still partly functional. PMID: 15009107
  45. the conformation of the NC16A domain and steric availability of the cleavage site influence shedding and is important for folding of collagen XVII PMID: 15047704
  46. C-terminus of collagen XVII binds to laminin 5, revealing the role of collagen XVII in the regulation of keratinocyte migration. PMID: 15161638
  47. Data show that the expression of laminin gamma2 chain and collagen type XVII is altered in endometrial adenocarcinomas. PMID: 15609083
  48. expression of BP180 is related to clinical severity of bullous pemphigoid PMID: 15734283
  49. Epitooe mapping of anti-BP180 immunoglobulin E autoantibodies in bullous pemphigoid. PMID: 16117787
  50. Deletions in recombinant proteins affect thermal stability. PMID: 16354180

Show More

Hide All

Involvement in disease
Generalized atrophic benign epidermolysis bullosa (GABEB); Epithelial recurrent erosion dystrophy (ERED)
Subcellular Location
Cell junction, hemidesmosome. Membrane; Single-pass type II membrane protein. Note=Localized along the plasma membrane of the hemidesmosome.; [120 kDa linear IgA disease antigen]: Secreted, extracellular space, extracellular matrix, basement membrane. Note=Exclusively localized to anchoring filaments. Localized to the epidermal side of split skin.; [97 kDa linear IgA disease antigen]: Secreted, extracellular space, extracellular matrix, basement membrane. Note=Localized in the lamina lucida beneath the hemidesmosomes.
Tissue Specificity
Detected in skin. In the cornea, it is detected in the epithelial basement membrane, the epithelial cells, and at a lower level in stromal cells (at protein level). Stratified squamous epithelia. Found in hemidesmosomes. Expressed in cornea, oral mucosa,
Database Links

HGNC: 2194

OMIM: 113811

KEGG: hsa:1308

STRING: 9606.ENSP00000340937

UniGene: Hs.117938

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*