Recombinant Human Collagen alpha-1 (XVIII) chain (COL18A1), partial

In Stock
Code CSB-EP005725HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cell Adhesion
Alternative Names
Alpha 1 collagen type 18 (XVIII)(COL18A1); Alpha 1 type XVIII collagen; Antiangiogenic agent; COIA1_HUMAN; COL15A1; Col18a1; Collagen alpha 1(XV) chain; Collagen alpha 1(XVIII) chain; Collagen alpha-1(XV) chain; Collagen type XV proteoglycan; Collagen type XVIII alpha 1; Collagen XV; alpha 1 polypeptide; Collagen; type XV; alpha 1; Endostatin; Endostatin XV; FLJ27325; FLJ34914; FLJ38566; KNO; KNO1; KS; MGC74745; Multi functional protein MFP; OTTHUMP00000021782; OTTHUMP00000115472; OTTHUMP00000115473
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1578-1754aa
Target Protein Sequence
QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
46.3kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Incorporation of the gene encoding the Human COL18A1 protein (1578-1754aa) into a plasmid vector forms recombinant plasmid, which is then transformed into e.coli cells. baculovirus cells containing the recombinant plasmid that can survive in the presence of a specific antibiotic are selected and cultured under conditions conducive to the expression of the gene of interest. The protein features a N-terminal GST tag fusion. Following expression, the recombinant Human COL18A1 protein is isolated and purified from the cell lysate using affinity purification. Denaturing SDS-PAGE is then employed to resolve the resulting recombinant protein, demonstrating a purity greater than 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Probably plays a major role in determining the retinal structure as well as in the closure of the neural tube.; May regulate extracellular matrix-dependent motility and morphogenesis of endothelial and non-endothelial cells; the function requires homotrimerization and implicates MAPK signaling.; Potently inhibits endothelial cell proliferation and angiogenesis. May inhibit angiogenesis by binding to the heparan sulfate proteoglycans involved in growth factor signaling. Inhibits VEGFA-induced endothelial cell proliferation and migration. Seems to inhibit VEGFA-mediated signaling by blocking the interaction of VEGFA to its receptor KDR/VEGFR2. Modulates endothelial cell migration in an integrin-dependent manner implicating integrin ITGA5:ITGB1 and to a lesser extent ITGAV:ITGB3 and ITGAV:ITGB5. May negatively regulate the activity of homotrimeric non-collagenous domain 1.
Gene References into Functions
  1. results suggested that common polymorphisms in these two candidate genes were unlikely to play major roles in the genetic susceptibility to HM. Nevertheless, to avoid filtering real myopia genes, the role of COL11A1 and COL18A1 in the pathogenesis of myopia requires more refinement in both animal models and human genetic epidemiological studies PMID: 29781737
  2. Increased serum levels of endostatin were associated with loss of graft function in kidney transplant recipients. PMID: 29528011
  3. endostatin may have a role in subclinical atherosclerosis as shown in a study of a healthy Japanese population PMID: 28428451
  4. a protease capable of producing endostatin from human Col XVIII, is reported PMID: 27921229
  5. Structural and biological functions of COL18A1, such as its requirement in the maintenance of basement membrane integrity and its emerging roles in regulating cell survival, stem or progenitor cell maintenance and differentiation and inflammation have been reported. (Review) PMID: 27746220
  6. Lower endostatin levels or a predominance of VEGF over endostatin are predictors of poor short-term prognosis of intracranial atherosclerotic stenosis. PMID: 28189572
  7. We further show that the SAGA deubiquitinase-activated gene Multiplexin (Mp) is required in glia for proper photoreceptor axon targeting. Mutations in the human ortholog of Mp, COL18A1, have been identified in a family with a SCA7-like progressive visual disorder, suggesting that defects in the expression of this gene in SCA7 patients could play a role in the retinal degeneration that is unique to this ataxia. PMID: 27261002
  8. Two COL18A1 variants co-segregated with familial epilepsy and anterior polymicrogyria in a family. PMID: 28602933
  9. Blood endostatin wasdddddddddddddddddddddddddf significantly higher in chronic hepatitis C patients with liver fibrosis compared to those without fibrosis. PMID: 27930387
  10. The homozygous DN and NN genotypes of COL18A1 D104N were associated with the risk of osteosarcoma. PMID: 26617886
  11. Endostatin is increased in patients with primary sjogren's syndrome patients with interstitial lung disease. PMID: 27214260
  12. Data show that endostatin levels were elevated in patients with systemic sclerosis (SSc) and mixed connective tissue disease (MCTD). PMID: 26315510
  13. promoter methylation significantly increased in nasal polyp tissues PMID: 26275402
  14. Collaterals formation seems to be associated with the activation of pro-inflammatory factors, growth factors and endostatin in chronic heart failure. PMID: 26771970
  15. Genebased analyses revealed associations of the COL18A1 gene with longitudinal Blood Pressure phenotypes, associations with essential hypertension, Blood Pressure salt sensitivity, preeclampsia, or preclinical stages of atherosclerosis. PMID: 25424718
  16. Study demonstrates that endostatin has novel ATPase activity, which mediates its antiangiogenic and antitumor activities. PMID: 25788476
  17. ADAM8 and endostatin play a role in osteosarcoma progression. PMID: 25481287
  18. High endostatin expression is associated with malignant pleural effusions in lung cancer. PMID: 25339042
  19. In 2 large cohort studies using serum endostatin as a marker for disease severity and mortality in pulmonary arterial hypertension, a variant in the gene encoding ES, Col18a1, was linked independently with reduced mortality. PMID: 25489667
  20. Serum endostatin is raised in older men who have symptoms of intermittent claudication. PMID: 24600079
  21. The ratio of VEGF/endostatin levels was significantly higher in operable non-small cell lung cancer patients than in normal controls. PMID: 24998915
  22. Female type 2 diabetes mellitus patients have higher serum endostatin levels than males and exercise increases levels in both sexes. PMID: 24393402
  23. Our preliminary findings provide new evidence that endostatin/collagen XVIII concentration in the CSF increases substantially in patients with sTBI PMID: 24089677
  24. Higher endostatin levels are associated with increased risk of early onset pre-eclampsia PMID: 23958573
  25. Hepatocellular carcinoma shows significantly elevated serum levels of angiogenic factors VEGF and Ang-2 and of anti-angiogenic factors endostatin and angiostatin. PMID: 23912396
  26. These results suggest genetic variation in COL15A1 and COL18A1 can modify the age of onset of both early and late onset POAG. PMID: 23621901
  27. data suggest that KS is only caused by biallelic mutations in COL18A1 PMID: 23667181
  28. indicative of good tumor blood supply and permeability of vasculature, are associated with high levels of collagen XVIII and VEGF expression PMID: 23605255
  29. High serum endostatin was associated with increased mortality risk in 2 independent community-based cohorts of the elderly. PMID: 24030549
  30. Transcription levels of VEGF and endostatin by RT-PCR may be an adjunct to cytology screening for early detection of cervical carcinomas and may determine the progressive potentiality of individual lesions, especially in high-risk patients. PMID: 24021340
  31. Binding of VEGF-C and endostatin to recombinant VEGFR-3 is competitive. PMID: 22512651
  32. common germline variants in Endostatin and eNOS genes have predictive significance for clinical outcome and survivality in advanced gastric cancer patients treated with first-line chemotherapy. PMID: 23641912
  33. Report pre/postoperative endostatin levels in surgically treated gastrointestinal cancers. PMID: 22819906
  34. a potential role for collagen XXIII in mediating metastasis by facilitating cell-cell and cell-matrix adhesion as well as anchorage-independent cell growth. PMID: 21963851
  35. Endostatin lowers blood pressure via nitric oxide and prevents hypertension associated with VEGF inhibition PMID: 22733742
  36. In osteosarcoma, expression of endostatin was positively correlated with that of CD34, and was greater in poorly differentiated osteosarcoma than in highly differentiated osteosarcoma. Expression of endostatin correlated with osteosarcoma metastasis. PMID: 22009965
  37. The detection of VEGF mRNA and endostatin mRNA appears to be suitable for distinguishing carcinoma cells from reactive mesothelial cells in pleural effusions, they could be useful to diagnose the pleural micrometastasis. PMID: 22431315
  38. Findings indicate that COL18A1 rs7499 may contribute to the risk of Hepatocellular carcinoma (HCC) in Han Chinese. PMID: 22461898
  39. Soluble FZC18 and Wnt3a physically interact in a cell-free system and soluble FZC18 binds the frizzled 1 and 8 receptors. PMID: 22303445
  40. study demonstrated significantly elevated endostatin levels in serum and urine samples of bladder cancer patients and show that high endostatin serum concentrations significantly correlate with the presence of lymph node metastasis PMID: 21815140
  41. Peripheral blood osteopontin (OPN) and endostatin (END) levels were studied in 35 patients with adrenal cortex tumors and 10 patients with pheochromocytoma before unilateral adrenalectomy, as well as in 10 healthy subjects (controls). PMID: 21968021
  42. Endostatin induces autophagy in endothelial cells by modulating Beclin 1 and beta-catenin levels PMID: 19298526
  43. Cysteine cathepsins S and L modulate anti-angiogenic activities of human endostatin. PMID: 21896479
  44. Endostatin can effectively inhibit rat peritoneum neoangiogenesis and the effect was dose-dependent. PMID: 21457400
  45. The aim of the study was to evaluate and compare the circulating concentrations of OPN, E-selectin and END of severely obese patients with metabolic syndrome before and after vertical banded gastroplasty. PMID: 21486700
  46. Common polymorphisms in four candidate genes (COL11A1, COL18A1, FBN1 and PLOD1) were unlikely to play important roles in the genetic susceptibility to high myopia. PMID: 21527992
  47. Lack of collagen XVIII long isoforms affects kidney podocytes, whereas the short form is needed in the proximal tubular basement membrane PMID: 21193414
  48. Data show that hypertriglyceridemia occurs in Knobloch patients lacking the vascular form of Col18. PMID: 21085708
  49. suggest that collagen XVIII/endostatin preserves the integrity of the extracellular matrix and capillaries in the kidney, protecting against progressive glomerulonephritis PMID: 20616167
  50. Elevated preoperative serum levels of endostatin in patients with clear cell renal cell carcinoma are associated with higher stage and grade. PMID: 19615205

Show More

Hide All

Involvement in disease
Knobloch syndrome 1 (KNO1)
Subcellular Location
Secreted, extracellular space, extracellular matrix. Secreted, extracellular space, extracellular matrix, basement membrane.; [Non-collagenous domain 1]: Secreted, extracellular space, extracellular matrix, basement membrane. Secreted.; [Endostatin]: Secreted. Secreted, extracellular space, extracellular matrix, basement membrane.
Protein Families
Multiplexin collagen family
Tissue Specificity
Present in multiple organs with highest levels in liver, lung and kidney.
Database Links

HGNC: 2195

OMIM: 120328

KEGG: hsa:80781

STRING: 9606.ENSP00000347665

UniGene: Hs.517356

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*