Recombinant Human Dual specificity protein phosphatase 22 (DUSP22)

Code CSB-EP865123HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
DUSP22
Uniprot No.
Research Area
Cell Biology
Alternative Names
Dual specificity protein phosphatase 22; DUS22_HUMAN; Dusp22; JNK stimulatory phosphatase 1; JNK-stimulatory phosphatase-1; JSP 1; JSP-1; JSP1; LMW DSP2; LMW-DSP2; Low molecular weight dual specificity phosphatase 2; MAP kinase phosphatase x; Mitogen activated protein kinase phosphatase x; Mitogen-activated protein kinase phosphatase x; MKP-x; MKPX
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-184aa
Target Protein Sequence
GNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
47.8kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Activates the Jnk signaling pathway.
Gene References into Functions
  1. JKAP/DUSP22 is downregulated in T cells of systemic lupus erythematosus nephritis PMID: 27557500
  2. Data show that dual specificity phosphatase 22 (DUSP22) functions as a tumor suppressor gene in peripheral T-cell lymphomas (PTCL). PMID: 27626696
  3. findings connect NOTCH1, DUSP22, and CCL19-driven chemotaxis within a single functional network, suggesting that modulation of the homing process may provide a relevant contribution to the unfavorable prognosis associated with NOTCH1 mutations in CLL. PMID: 28017968
  4. findings suggest that CCR8 expression in ALCL is more closely related to the presence of DUSP22 rearrangements than to cutaneous involvement and that the function of CCR8 may extend beyond its skin-homing properties in this disease PMID: 25390351
  5. Studies suggest that the presence of dual specificity phosphatase 22 (DUSP22) and p63 tumor suppressor protein (TP63) rearrangements might be useful to support a diagnosis of anaplastic lymphoma kinase (ALK)-negative anaplastic large cell lymphoma (ALCL). PMID: 26223379
  6. Report morphologic features of ALK-negative anaplastic large cell lymphomas with DUSP22 gene rearrangements. PMID: 26379151
  7. Reduced DUSP22 expression was found in colorectal cancer specimens. Low expression level of DUSP22 in stage IV patients had a poor survival outcome PMID: 26032091
  8. The structure illuminates the molecular basis for substrate binding and may also facilitate the structure-assisted development of DUSP22 inhibitors. PMID: 25664796
  9. study identified presence of promoter hypermethylation of the DUSP22 gene in Alzheimer's disease(AD); DUSP22 is a likely candidate gene for involvement in the pathogenesis of AD since it inhibits PKA activity and thereby determines TAU phosphorylation status and CREB signaling PMID: 24436131
  10. Biallelic rearrangements of DUSP22 is found in CD30-positive T-cell lymphoproliferative disorders. PMID: 23337887
  11. Firefighters had a higher prevalence of dual specificity phosphatase 22-promoter hypomethylation in blood DNA (P = 0.03) and the extent of hypomethylation correlated with duration of firefighting service (P = 0.04) but not with age. PMID: 22796920
  12. Data show that t(6;7)(p25.3;q32.3) was associated with down-regulation of DUSP22 and up-regulation of MIR29 microRNAs on 7q32.3. PMID: 21030553
  13. a new role for JKAP in the modulation of FAK phosphorylation and cell motility. PMID: 20018849
  14. The crystal structre showed 1 domain with 6 alpha helices & 5 beta strans, a PTP-loop at the active site binding MES, and an Ala instead of a Trp at the substrate-stacking loop. PMID: 17068812
  15. DUSP22 acts as a negative regulator of the estrogen receptor alpha-mediated signaling pathway in breast cancer cells. PMID: 17384676

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Protein-tyrosine phosphatase family, Non-receptor class dual specificity subfamily
Tissue Specificity
Ubiquitous. Highest expression seen in heart, placenta, lung, liver, kidney and pancreas.
Database Links

HGNC: 16077

KEGG: hsa:56940

STRING: 9606.ENSP00000345281

UniGene: Hs.29106

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*