Recombinant Human Dynein light chain roadblock-type 1 (DYNLRB1), partial

Code CSB-EP865093HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
DYNLRB1
Uniprot No.
Research Area
Cancer
Alternative Names
DYNLRB1; BITH; DNCL2A; DNLC2A; ROBLD1; HSPC162Dynein light chain roadblock-type 1; Bithoraxoid-like protein; BLP; Dynein light chain 2A; cytoplasmic; Dynein-associated protein Km23; Roadblock domain-containing protein 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
3-96aa
Target Protein Sequence
EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
26.7kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules.
Gene References into Functions
  1. Human colorectal carcinoma cells display decreased tumor progression and invasion when a novel anti-cell motility target, DYNLRB1, is being silenced. PMID: 23755307
  2. TGFbeta regulates km23-1 interaction with the R1beta regulatory subunit of protein kinase A. PMID: 23333499
  3. these findings demonstrate that km23-1 regulates RhoA and motility-associated actin modulating proteins, suggesting that km23-1 may represent a novel target for anti-metastatic therapy. PMID: 23079622
  4. km23-1 is required for TGFbeta1 autoinduction through Smad2-independent Ras/ERK/JNK pathways PMID: 22637579
  5. Silencing of km23, either through somatic genetic mutation or promoter hypermethylation, is rare in ovarian, breast, and colorectal cancers. PMID: 16778097
  6. report the 2.1-A crystal structure of Dnlc2A using single anomalous diffraction PMID: 16970917
  7. Infrequently mutated in human colorectal and gastric cancers. PMID: 17556076
  8. DYNLRB1 specifically interacts with all three Rab6 isoforms and co-localises at the Golgi. PMID: 18044744
  9. Identification of dynein light chain road block-1 as a novel interaction partner with the human reduced folate carrier. PMID: 19571232

Show More

Hide All

Subcellular Location
Cytoplasm, cytoskeleton.
Protein Families
GAMAD family
Tissue Specificity
High expression in heart, liver, brain and pancreas; moderate in placenta, skeletal muscle and kidney; low in lung, prostate, testis, small intestine and colon. Isoform 1 expression is up-regulated in 64% hepatocellular carcinoma (HCC) patients.
Database Links

HGNC: 15468

OMIM: 607167

KEGG: hsa:83658

STRING: 9606.ENSP00000349679

UniGene: Hs.593920

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*