Recombinant Human Histone-binding protein RBBP7 (RBBP7)

In Stock
Code CSB-EP621959HU
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
RBBP7
Uniprot No.
Research Area
Transcription
Alternative Names
G1/S transition control protein binding protein RbAp46; Histone acetyltransferase type B subunit 2; Histone binding protein RBBP7; Histone-binding protein RBBP7; MGC138867; MGC138868; Nucleosome remodeling factor subunit RBAP46; Nucleosome-remodeling factor subunit RBAP46; RBAP46; RBBP 7; RBBP-7; RBBP7; RBBP7_HUMAN; Retinoblastoma binding protein 7; Retinoblastoma binding protein p46; Retinoblastoma-binding protein 7; Retinoblastoma-binding protein p46; Retinoblastoma-binding protein RbAp46
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-425aa
Target Protein Sequence
MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKINHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGYGLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHESLFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSELEGQGS
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
63.8kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Human RBBP7 covers amino acids 1-425. This RBBP7 protein is expected to have a theoretical molecular weight of 63.8 kDa. The RBBP7 protein was expressed in e.coli. Fusion of the N-terminal 6xHis-SUMO tag into the RBBP7 encoding gene fragment was conducted, allowing for easier detection and purification of the RBBP7 protein in subsequent stages.

Human Retinoblastoma-Binding Protein 7 (RBBP7) is a histone-binding protein essential for chromatin remodeling and gene regulation. As a subunit of various chromatin-modifying complexes, RBBP7 participates in epigenetic processes, influencing transcriptional activation and repression. In cell cycle regulation, RBBP7 interacts with tumor suppressor proteins, impacting cell proliferation. In cancer research, RBBP7 is implicated in tumorigenesis and metastasis, making it a potential therapeutic target. Additionally, RBBP7 plays a role in stem cell maintenance and differentiation. Investigating RBBP7's functions enhances the understanding of epigenetic mechanisms, offering avenues for research in cancer biology, developmental biology, and therapeutic strategies targeting chromatin dynamics.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : GST-pull down

Review: The pull-down assay with purifi ed protein C3b and bacterially expressed GST-HDAC1/2, -RBBP4, -SAP18, -ING2 and His-Sumo_x005fRBBP7 further revealed that C3b could interact with RBBP4/7, HDAC1/2, SAP18 and ING2 directly.

By Anonymous

Target Background

Function
Core histone-binding subunit that may target chromatin remodeling factors, histone acetyltransferases and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the type B histone acetyltransferase (HAT) complex, which is required for chromatin assembly following DNA replication; the core histone deacetylase (HDAC) complex, which promotes histone deacetylation and consequent transcriptional repression; the nucleosome remodeling and histone deacetylase complex (the NuRD complex), which promotes transcriptional repression by histone deacetylation and nucleosome remodeling; and the PRC2/EED-EZH2 complex, which promotes repression of homeotic genes during development; and the NURF (nucleosome remodeling factor) complex.
Gene References into Functions
  1. show that BCL11A(2-16) pulls down RBBP4, RBBP7, and other components of PRC2, NuRD, and SIN3A from the cell lysate of the TNBC cell line SUM149 PMID: 29263092
  2. RBBP7 controls the stability of HUWE1.RBBP7 is the E3 ligase responsible for the proteasomal degradation of HUWE1. PMID: 29738775
  3. Taken together with previous findings this suggests, that MTA-RBBP is a stable complex, with a central role in the initial assembly of the human NuRD complex. PMID: 28179136
  4. NKX6.1 directly enhances the mRNA level of E-cadherin by recruiting BAF155 coactivator and represses that of vimentin and N-cadherin by recruiting RBBP7 (retinoblastoma binding protein 7) corepressor. PMID: 26257059
  5. Results show a novel interaction of the Lsm4 RGG domain with HAT1 and RBBP7, leading to the possibility of a posttranslational modifications network involved in mRNP regulation. PMID: 27247266
  6. the CRL4 complex containing RBBP7 (CRL4(RBBP7)) might regulate mitosis by promoting ubiquitin-dependent loading of newly synthesized CENP-A during the G1 phase of the cell cycle. PMID: 25795299
  7. Ras induced RbAp46 expression increases invasion of bladder cancer cells. PMID: 25885317
  8. Both of RbAp46 mRNA and protein levels were upregulated significantly in NSCLC cancer tissues. Serum levels of RbAp46 were markedly higher in NSCLC patients than in healthy controls. PMID: 19655816
  9. RbAp46 expression suppresses the transformed phenotypes of breast cancer cells, and dysregulation of RbAp46 expression may contribute to breast cancer tumorigenesis. PMID: 14666671
  10. RbAp46 inhibits cell growth and suppresses the transformed phenotypes of tumor cell lines. PMID: 14981905
  11. RT-PCR data show high expression of putative tumor suppressor genes Rsk4 and RbAp46 in 47% and 79% of breast carcinoma cases, respectively, whereas Cldn2 was down-regulated in 52% of breast cancer cases compared with normal adjacent tissues. PMID: 17314274
  12. RbAp46 folds into a seven-bladed beta propeller structure and binds histone H4 in a groove formed between an N-terminal alpha helix and an extended loop inserted into blade six. PMID: 18571423

Show More

Hide All

Subcellular Location
Nucleus.
Protein Families
WD repeat RBAP46/RBAP48/MSI1 family
Database Links

HGNC: 9890

OMIM: 300825

KEGG: hsa:5931

STRING: 9606.ENSP00000369424

UniGene: Hs.495755

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*