Recombinant Human Interferon kappa (IFNK)

Code CSB-YP889172HUk3
MSDS
Size $368
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
(IFN-kappa)
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
28-207aa
Target Protein Sequence
LDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
80.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-PDI-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role in the regulation of immune cell function. Cytokine that imparts cellular protection against viral infection in a species-specific manner. Activates the interferon-stimulated response element signaling pathway. It is able to directly modulate cytokine release from monocytes and dendritic cells. Binds heparin.
Gene References into Functions
  1. investigation of common variable immunodeficiency (CVID) from 2 German families; report on the occurrence of a common and one novel truncating IFNK mutation in cases with CVID; the frequency distribution of c.30_31insTGTT in cases and controls as well as the observed segregation patterns in CVID families exclude IFNK mutations as major risk factor in CVID PMID: 28324805
  2. These results suggest that high-risk human papillomavirus 31 target interferon kappa to prevent Sp100 expression and identify Sp100 as an interferon-stimulated gene with anti-human papillomavirus activity. PMID: 26491169
  3. This study demonstrates that E2 proteins of high risk human papillomavirus reduce STING and IFN-kappa transcription. PMID: 24614210
  4. The viral E6 and E7 oncogenes are sufficient for interferon-kappa repression, with E6 being mainly responsible. PMID: 21849431
  5. IFN-kappa is down-regulated in cervical keratinocytes harboring HPV, which may be a contributing factor in the progression of a cervical lesion PMID: 20479716
  6. Studied IFNK single nucleotide polymorphisms in 3982 Systemic lupus erythematosus cases and 4275 controls. PMID: 20706608
  7. IFN-kappa is able to directly modulate cytokine release from monocytes and dendritic cells, inhibit inducible IL-12 release from monocytes, and bind strongly to heparin. PMID: 12391192
  8. This is the first report showing an epigenetic silencing of type I IFN after HPV16 oncogene expression PMID: 19887612

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Alpha/beta interferon family
Tissue Specificity
Expressed in keratinocytes, monocytes and in resting dendritic cells.
Database Links

HGNC: 21714

OMIM: 615326

KEGG: hsa:56832

STRING: 9606.ENSP00000276943

UniGene: Hs.591083

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*