Recombinant Human Lymphotactin protein (XCL1)

Code CSB-RP096274h
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
ATAC; C motif chemokine 1; Chemokine (C motif) ligand 1; Chemokine C Motif Ligand 1; Cytokine SCM-1; LPTN; LTN; Lymphotactin; Lymphotaxin; SCM 1 alpha; SCM 1; SCM 1a; SCM-1-alpha; SCM1; SCM1A; SCYC1; Single cysteine motif 1a; Small inducible cytokine C1; Small Inducible Cytokine Subfamily C Member 1; Small inducible cytokine subfamily C, member 1 (lymphotactin); Small-inducible cytokine C1; X-C motif chemokine ligand 1; XC chemokine ligand 1; Xcl1; XCL1_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
22-114aa
Target Protein Sequence
VGSEVSDKRTCVSLTTQRLPVSRIKTYTITEGSLRAVIFITKRGLKVCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
14.3kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Chemotactic activity for lymphocytes but not for monocytes or neutrophils. In thymus, mediates medullary accumulation of thymic dendritic cells and contributes to regulatoy T cell development, playing a role in self-tolerance establishment.
Gene References into Functions
  1. higher serum XCL1 levels at diagnosis and their progressive decline throughout chemotherapy could be correlated with higher survival. PMID: 29027574
  2. This study defines a Glycosaminoglycan binding surface on XCL1 dimer that includes residues that are important for HIV-1 inhibition. PMID: 26836755
  3. Electrostatics and Hydrophobic Effects in the Metamorphic Protein Human Lymphotactin PMID: 26134347
  4. XCL1 acts via direct interaction with the external viral envelope glycoprotein, gp120, to block HIV-1 infection PMID: 26085164
  5. analysis of XCL1 and XCL2, members of the C-chemokine subfamily, in the immune system PMID: 25497737
  6. XCL1 displays antimicrobial activity against E. coli and S. aureus. PMID: 12949249
  7. XCL1-mediated inhibition is associated with direct interaction of the chemokine with the HIV-1 envelope. PMID: 24385911
  8. In native annulus fibrosus tissue homeostasis and repair, CXCR3 is evident, whereas XCL1 could not be detected. PMID: 21270681
  9. The expression patterns of XCR1 and XCL1 were conserved in human and mice blood cells, including certain dendritic cell subsets. PMID: 20541533
  10. Data indicated increased expression of XCL1 in CD4+ and CD8+ T cells in Wegener's granulomatosis (WG), and suggest that XCL1 might be a key modulator of T cell recruitment in WG. PMID: 19797511
  11. NMR spectra of human lymphotactin (hLtn), obtained under various solution conditions, have revealed that the protein undergoes a major conformational rearrangement dependent on temperature and salt concentration. PMID: 11889129
  12. lymphotactin, as well as MCP-1, may contribute to leukocyte infiltration and disease progression in IgA nephropathy. PMID: 12053063
  13. Lptn might be a key modulator for T cell trafficking in the pathogenesis of rheumatoid arthritis PMID: 12847680
  14. In humans XCL1 expression is mainly a property of CD8+ T cells; the contribution to its synthesis by different T cell receptor alpha beta-expressing T cell subsets, namely CD4+ lymphocytes, is negligible. PMID: 14568926
  15. lymphotactin utilizes highly specific glycosaminoglycan-binding sites PMID: 14707146
  16. XCL1 activation is positively correlated with HIV-1 Tat expression in human U87.MG astrocytes in vitro. PMID: 14734774
  17. description of a lymphotactin-producing monoclonal T-cell lymphoproliferative disorder with extreme lymphocytopenia and progressive leukoencephalopathy [case report] PMID: 16923584
  18. The monocyte-derived dendritic cells can express Lptn mRNA in a maturation-dependent manner. PMID: 17077010
  19. Elevated serum lymphotactin levels correlate with relatively milder manifestations in diffuse cutaneous systemic sclerosis (dSSc), especially lower severity of lung involvement, suggesting that lymphotactin may play a role in the development of dSSc. PMID: 18322986
  20. functional repertoire and regulation of a single naturally occurring amino acid sequence can be expanded by access to a set of highly dissimilar native-state structures PMID: 18364395
  21. XCL1 enhances regulatory activities of CD4+ CD25(high) CD127(low/-) T cells in human allergic asthma PMID: 18832695
  22. ATAC Is a GCN5/PCAF-containing acetylase complex with a novel NC2-like histone fold module that interacts with the TATA-binding protein PMID: 18838386

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Intercrine gamma family
Tissue Specificity
Highest level in spleen, lower in peripheral leukocytes and very low levels in lung, colon and small intestine.
Database Links

HGNC: 10645

OMIM: 600250

KEGG: hsa:6375

STRING: 9606.ENSP00000356792

UniGene: Hs.458346

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*