Recombinant Human Sperm-egg fusion protein Juno (IZUMO1R)

Code CSB-YP008789HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP008789HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP008789HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
IZUMO1R; FOLR4; JUNO; Sperm-egg fusion protein Juno; Folate receptor 4; Folate receptor delta; FR-delta; IZUMO1 receptor protein JUNO
Species
Homo sapiens (Human)
Expression Region
20-250
Target Protein Sequence
G DELLNICMNA KHHKRVPSPE DKLYEECIPW KDNACCTLTT SWEAHLDVSP LYNFSLFHCG LLMPGCRKHF IQAICFYECS PNLGPWIQPV GSLGWEVAPS GQGERVVNVP LCQEDCEEWW EDCRMSYTCK SNWRGGWDWS QGKNRCPKGA QCLPFSHYFP TPADLCEKTW SNSFKASPER RNSGRCLQKW FEPAQGNPNV AVARLFASSA PSWELSYTIM VCSLFLPFLS
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

We are interest in the following product CSB-BP008789HU.
But we have following questions:
Is there a possibility to order clones or constructs that you use for these proteins?
We are also interested in human Iodothyronine deiodinase Type II and Type III. We would like to have the proteins with selenocysteine residues. However the according to the latest information on your website, the selenocysteines have been mutated instead of using a SECIS element. Could you please let me know if you can generate these proteins without mutations. We are also interested in the clones or constructs.

A:
Very nice to receive your inquiry.
Recombinant Human Sperm-egg fusion protein Juno(IZUMO1R)
CSB-BP008789HU >> Baculovirus
Expression Region: 20-250aa; Full length of the mature protein.
Tag information: Tag type will be determined during the manufacturing process.
The expected tag is N-terminal 6xHis-tagged
Sequence:

GDELLNICMNAKHHKRVPSPEDKLYEECIPWKDNACCTLTTSWEAHLDVSPLYNFSLFHCGLLMPGCRKHFIQAICFYECSPNLGPWIQPVGSLGWEVAPSGQGERVVNVPLCQEDCEEWWEDCRMSYTCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKASPERRNSGRCLQKWFEPAQGNPNVAVARLFASSAPSWELSYTIMVCSLFLPFLS


1. Sorry, we can't provide the constructs, but the clone is available if you need, pUC vector, lead time is 5-10 working days.
2.The quotations for Human Type II iodothyronine deiodinase(DIO2) (CSB-XP821705HU1 series) and Human Thyroxine 5-deiodinase(DIO3) (CSB-XP345038HU series) were provided to you through email.
The reason why we provided the mutated sequences were also explained in the email. Sorry, we can't provide the original sequence without mutation, and the corresonding clone and contructes can't be provided.The "U" selenocysteine is encoded by UGA and it's normally used as a stop codon in prokaryotic cells, which will lead to early termination of translation, so we will mutate this selenocysteine.

Target Background

Function
Receptor for IZUMO1 present at the cell surface of oocytes (oolemma), which is essential for species-specific gamete recognition and fertilization. The IZUMO1:IZUMO1R/JUNO interaction is a necessary adhesion event between sperm and egg that is required for fertilization but is not sufficient for cell fusion. The ligand-receptor interaction probably does not act as a membrane 'fusogen'. Does not bind folate.
Gene References into Functions
  1. Juno single nucleotide polymorphisms associated with fertilization failure and polyspermy after in vitro fertilization in women. PMID: 29243140
  2. JUNO interacts with IZUMO1 during sperm binding. PMID: 27416963
  3. crystal structures of human IZUMO1, JUNO and the IZUMO1-JUNO complex, establishing the structural basis for the IZUMO1-JUNO-mediated sperm-oocyte interaction PMID: 27309808
  4. crystal structures of human IZUMO1 and JUNO in unbound and bound conformations PMID: 27309818
Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Protein Families
Folate receptor family
Database Links

HGNC: 32565

OMIM: 615737

KEGG: hsa:390243

STRING: 9606.ENSP00000416935

UniGene: Hs.553758

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1