Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
CD 24; CD24; CD24 antigen (small cell lung carcinoma cluster 4 antigen); CD24 antigen; CD24 molecule; CD24_HUMAN; CD24A; FLJ22950; FLJ43543; GPI linked surface mucin; Heat stable antigen; HSA; MGC75043; Nectadrin; Signal transducer CD24; Small cell lung carcinoma cluster 4 antigen
Species
Homo sapiens (Human)
Expression Region
27-80aa
Target Protein Sequence
SETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The fusion tag N-terminal GST tag gene was added to the gene sequence corresponding to the E.coli of the human CD24 protein to form the recombinant DNA. The recombinant DNA was cloned into the expression vector and then transformed into the E.coli for expression. Following purification, the product is the recombinant human CD24 protein carrying N-terminal GST tag. The SDS-PAGE assessed the purity of this recombinant CD24 protein up to 90%. It had an apparent molecular weight of approximately 30 kDa. This recombinant CD24 protein may be used in CD24-associated immunology research.
CD24 is a gene providing instructions for making a protein named signal transducer CD24 and belongs to CD24 family. CD24 is a signal-transducing molecule on the surfaces of most human B cells that can modulate their response to activation signals by antagonizing IL-induced differentiation into antibody-forming cells and inducing proliferation in combination with signals generated by Ag receptors. Emerging evidence indicated that CD24 suppresses the germ cell program and promotes an ectodermal rather than mesodermal cell fate in embryonal carcinomas.