Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Thymic stromal lymphopoietin; Thymic stromal lymphopoietin protein TSLP; Tslp; TSLP protein; TSLP_HUMAN
Species
Homo sapiens (Human)
Expression Region
29-159aa
Target Protein Sequence
YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The synthesis of this Recombinant Human TSLP protein depends on the utilization of recombinant DNA technology to a large degree. DNA sequences that encoded the TSLP protein could be inserted into a vector and introduced into an expression host, Mammalian cell, where it could be easily expressed in and purified from. The expression of this TSLP protein was at 29-159aa. N-terminal 6xHis tag was fused with this protein. The purity is 90%+ determined by SDS-PAGE.
TSLP is gene encoding a protein named thymic stromal lymphopoietin (TSLP) in human. The encoded protein TSLP) is an interleukin-7-like cytokine produced by epithelial cells and is reported to be upregulated in asthma and induce dendritic cell maturation supporting a Th2 response. It has been called a “master switch” of allergic inflammation at the epithelial cell and dendritic cell interface. Moreover, this protein also displays a defense response to fungus and defense response to Gram-negative bacterium.