Recombinant Moloney murine leukemia virus Gag polyprotein (gag), partial

Code CSB-YP356017MHK
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP356017MHK-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP356017MHK
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP356017MHK
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
gag; Gag polyprotein; Pr65gag; Core polyprotein) [Cleaved into: Matrix protein p15; MA); RNA-binding phosphoprotein p12; pp12); Capsid protein p30; CA); Nucleocapsid protein p10-Gag; NC-gag)]
Species
Moloney murine leukemia virus (isolate Shinnick) (MoMLV)
Expression Region
216-478aa
Target Protein Sequence
PLRAGGNGQLQYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLITHQPTWDDCQQLLG TLLTGEEKQRVLLEARKAVRGDDGRPTQLPNEVDAAFPLERPDWDYTTQAGRNHLVHYRQ LLLAGLQNAGRSPTNLAKVKGITQGPNESPSAFLERLKEAYRRYTPYDPEDPGQETNVSM SFIWQSAPDIGRKLERLEDLKNKTLGDLVREAEKIFNKRETPEEREERIRRETEEKEERR RTEDEQKEKERDRRRHREMSKLL
Protein Length
partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Which mammalian cell is used to manufacture this recombinant protein?

A:

The host cell that we generally use for Mammalian cell expression system is HEK295 cells.

Target Background

Function
Plays a role in budding and is processed by the viral protease during virion maturation outside the cell. During budding, it recruits, in a PPXY-dependent or independent manner, Nedd4-like ubiquitin ligases that conjugate ubiquitin molecules to Gag, or to Gag binding host factors. Interaction with HECT ubiquitin ligases probably links the viral protein to the host ESCRT pathway and facilitates release.; Targets Gag and gag-pol polyproteins to the plasma membrane via a multipartite membrane binding signal, that includes its myristoylated N-terminus. Also mediates nuclear localization of the pre-integration complex.; Constituent of the pre-integration complex (PIC) which tethers the latter to mitotic chromosomes.; Forms the spherical core of the virion that encapsulates the genomic RNA-nucleocapsid complex.; Involved in the packaging and encapsidation of two copies of the genome. Binds with high affinity to conserved UCUG elements within the packaging signal, located near the 5'-end of the genome. This binding is dependent on genome dimerization.
Gene References into Functions
  1. The structure of the minimal sequence of the murine leukemia virus p12 protein necessary for the host chromatin binding was elucidated. PMID: 27707926
  2. Phosphorylation requirement of murine leukemia virus p12 virus p12 protein necessary for the host chromatin binding was elucidated. PMID: 27707931
  3. The N-terminal intracellular domain of the glycoGag is responsible for its effect on HIV-1 infectivity. PMID: 24403584
  4. Authors found that mature Gag proteins MA and TM were bound to the immature core consisting of the Gag polyprotein (PrGag) and viral RNA (vRNA). PMID: 23643491
  5. in presence of nucleocapsid (NC) chaperone, RNA dimerization occurred rapidly through a single structural intermediate; NC interacted primarily with guanosine residues; results show RNA chaperones can simplify RNA folding landscapes by weakening intramolecular interactions involving guanosine PMID: 23470731
  6. selective packaging of dimeric RNA is explained by the nucleic acid binding domain derived from Gag binding within the virus to the sequence UCUG-UR-UCUG PMID: 20974908
  7. results suggest a cooperative effect of p12 and capsid during the early events of MLV replication PMID: 15767417
  8. interaction of Gag with Tsg101 and Alix favors budding from the plasma membrane and relieves a requirement for ubiquitination by Nedd4 PMID: 15908698
  9. results indicate that glycosylated gag protein is important for M-MuLV replication in vivo and in vitro and that the protein may be involved in a late step in viral budding or release PMID: 17267509
  10. Abl protein contribute to proper localization by playing a dominant role in trafficking of the v-Abl molecule PMID: 18367522
  11. Basal budding and replication of the murine leukemia virus are independent of the gag L domains PMID: 18667521

Show More

Hide All

Subcellular Location
[Gag polyprotein]: Virion. Host cell membrane; Lipid-anchor. Host late endosome membrane; Lipid-anchor. Host endosome, host multivesicular body.; [Matrix protein p15]: Virion.; [Capsid protein p30]: Virion.; [Nucleocapsid protein p10-Gag]: Virion.; [RNA-binding phosphoprotein p12]: Host cytoplasm.
Database Links

KEGG: vg:1491870

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1