Recombinant Mouse Gamma-synuclein(Sncg)

Code CSB-EP5197MOb1
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Sncg
Uniprot No.
Research Area
Neuroscience
Alternative Names
Persyn
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
1-123aa
Target Protein Sequence
MDVFKKGFSIAKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVANKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEENEEAKSGED
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
18.3 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in neurofilament network integrity. May be involved in modulating axonal architecture during development and in the adult. In vitro, increases the susceptibility of neurofilament-H to calcium-dependent proteases. May also function in modulating the keratin network in skin. Activates the MAPK and Elk-1 signal transduction pathway.
Gene References into Functions
  1. results indicate that gamma-synuclein is capable of binding to synaptic vesicles, but the mechanism of its interaction with these structures is fundamentally different from the mechanism proposed for alpha-synuclein PMID: 24993968
  2. The results of this study suggested that gamma-synuclein is directly involved in the regulation of cognitive functions. PMID: 23672583
  3. gamma-Synuclein binds synaptic vesicles but is unable to rescue the phenotype of CSPalpha-deficient mice. PMID: 23129765
  4. gamma-synuclein is a regulator of lipid handling in adipocytes, the function of which is particularly important in conditions of nutrient excess PMID: 23213245
  5. Synuclein-alpha, -beta, and -gamma are important in regulating neurotransmitter release from specific populations of midbrain dopamine neurons through mechanisms that differ from those reported in other neurons. PMID: 21593311
  6. The loss of gamma-synuclein results in a significant increase in the level of orientation response in novel environment and decrease in the level of state anxiety. PMID: 21469331
  7. gamma-Synuclein is necessary for the increased Mac-2 expression by myelination-transition-zone astrocytes during glaucoma. PMID: 21199938
  8. The effects of gamma-synuclein deficiency on motor and peripheral sensory neurons were studied. Gamma-synuclein is dispensable for the development and function of the nervous system. PMID: 14585981
  9. Immunohistochemistry demonstrates accelerated accumulation of gamma-synuclein in gracile axonal dystrophy mice. Gamma-synuclein appears in the gracile nucleus at 3 weeks of age and was maintained until 32 weeks. PMID: 15306232
  10. These data indicate the chaperone activity of SNCG on stimulation of steroid receptor signaling in mammary gland. PMID: 17016445
  11. Groups of genes that were similarly altered in SNCA deficient and SNCG deficient mice, leading to nerve degeneration. PMID: 17318638
  12. Together, our data suggest an early role for SYN and inflammation in PD pathogenesis. PMID: 17537546
  13. loss of both alpha- and gamma-synuclein causes an increase in release probability from dopaminergic synapses PMID: 18333965
  14. Mice expressing high levels of gamma-synuclein develop severe and fatal neurological disease. PMID: 19246516

Show More

Hide All

Subcellular Location
Cytoplasm, perinuclear region. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Cytoplasm, cytoskeleton, spindle.
Protein Families
Synuclein family
Tissue Specificity
Highly expressed in brain, particularly in the substantia nigra. Also expressed in the corpus callosum, heart, skeletal muscle, ovary, testis, colon and spleen. Weak expression in pancreas, kidney and lung. Expressed predominantly in the cell bodies and a
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*