Recombinant Mouse H-2 class II histocompatibility antigen gamma chain (Cd74), partial

In Stock
Code CSB-EP004956MO
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP004956MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cd74.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP004956MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Cd74.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Cd74; Ii; H-2 class II histocompatibility antigen gamma chain; Ia antigen-associated invariant chain; Ii; MHC class II-associated invariant chain; CD antigen CD74) [Cleaved into: Class-II-associated invariant chain peptide; CLIP)]
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
56-279aa
Target Protein Sequence
QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
29.4kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 56-279 form the expressed segment for recombinant Mouse Cd74. The expected molecular weight for the Cd74 protein is calculated to be 29.4 kDa. This protein is generated in a e.coli-based system. The N-terminal 6xHis tag was fused into the coding gene segment of Cd74, making it easier to detect and purify the Cd74 recombinant protein in the later stages of expression and purification.

The H-2 class II histocompatibility antigen gamma chain (CD74) is a protein that has been extensively studied across various research domains. In immunology, CD74 takes center stage in the field of antigen presentation. As a key player in the major histocompatibility complex class II (MHC-II) pathway, it plays a crucial role in presenting antigens to immune cells, facilitating the initiation of immune responses. In the context of inflammatory and autoimmune diseases, CD74 has emerged as a significant target for investigation. Its involvement in modulating immune responses makes it a potential candidate for therapeutic interventions aimed at regulating immune activity in conditions like rheumatoid arthritis and inflammatory bowel disease. Furthermore, CD74 has been implicated in cancer research. Its expression patterns and functions in tumor cells and the tumor microenvironment are of interest in understanding how cancer cells evade the immune system and promote tumor growth.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to compartments where peptide loading of class II takes place. Enhance also the stimulation of T-cell responses through interaction with CD44.; Stabilizes the conformation of mature CTSL by binding to its active site and serving as a chaperone to help maintain a pool of mature enzyme in endocytic compartments and extracellular space of antigen-presenting cells (APCs).; Binds to the peptide-binding site of MHC class II alpha/beta heterodimers forming an alpha-beta-CLIP complex, thereby preventing the loading of antigenic peptides to the MHC class II complex until its release by HLA-DM in the endosome.
Gene References into Functions
  1. House dust mites sensitization lowered humoral immune responses to intact pneumococcus and this effect was significantly modified by the HLA-DR polymorphism. PMID: 27506953
  2. Data highlight the complexity of the MIF/CD74 signaling pathway in the development of mesothelioma. PMID: 26883190
  3. We demonstrate that MHCII is dispensable for the B cell phenotype of (signal peptide peptidase-like 2a) SPPL2a(-/-) mice, further supporting a CD74-intrinsic effect. PMID: 28550201
  4. CLIP expression and activated gamma-delta T cells are responsible for the development of preeclampsia. PMID: 28642294
  5. MIF-CD74 signaling inhibits interferon (IFN)-gamma secretion in microglia through phosphorylation of microglial ERK1/2 (extracellular signal-regulated protein kinases 1 and 2). The inhibition of MIF signaling or its receptor CD74 promotes IFN-gamma release and amplifies tumor death either through pharmacological inhibition or through siRNA-mediated knockdown. PMID: 27157615
  6. Ii mediated pathways play a vital role in the initiation and propagation of liver inflammation. PMID: 27371158
  7. CD74-knockout mice showed disturbed placental morphology, reduced junctional zone, smaller placentas, and impaired spiral artery remodeling with fetal growth restriction. PMID: 27199465
  8. explored CD74 expression, which can form a complex with CD44, in glomerular parietal epithelial cells during the progression of a model of focal segmental glomerulosclerosis PMID: 27463800
  9. might play roles in both the middle ear and inner ear in lipopolysaccharide-induced otitis media PMID: 27181906
  10. Data show that cathepsins S (CatS) regulates CCL2 chemokine expression by modulation of CD74 antigen processing. PMID: 26358505
  11. Suggest that the DQA1*0103/CD74 dimer may result in presentation of unique antigens and susceptibility to develop arthritis. PMID: 26524976
  12. CD74 plays a critical role in the MIF inhibition of osteoclastogenesis. PMID: 23044992
  13. Genetic deletion of CD74 restored the ability of infected dendritic cells to present a parasite antigen in the context of MHC-II. PMID: 26195549
  14. SPPL2a-mediated processing of CD74 NTF is indispensable to maintain appropriate levels of tonic BCR signaling to promote B cell maturation. PMID: 26157172
  15. Results support the hypothesis that neurodegeneration following traumatic brain injury is dependent upon antigen processing and presentation that requires CD74 PMID: 25329434
  16. Methylglyoxal induced gene expression of CD74 in the in the diabetic retina. PMID: 24974304
  17. In TPA-induced skin inflammation, MIF is released from damaged keratinocytes and then triggers the chemotaxis of CD74(+)CXCR2(+) NKT cells for IFN-gamma production. PMID: 25172501
  18. MIF promotes the migration of B cells through a ZAP-70-dependent pathway mediated by cooperative engagement of CXCR4 and CD74. PMID: 24760155
  19. These results demonstrate natural antagonist activity of DRalpha1 for macrophage migration inhibitory factor PMID: 24683185
  20. Recombinant vaccinia virus vaccines encoding CD74 may be useful tools to improve CD4 T-cell responses to viral and tumour antigens. PMID: 24205828
  21. Macrophage migration inhibitory factor receptor CD74 mediates alphavirus-induced arthritis and myositis in murine models of alphavirus infection. PMID: 23896945
  22. These findings implicate binding of recombinant T-cell receptor ligand constructs to CD74 as a key step in both antigen-driven and bystander T-cell tolerance important in treatment of inflammatory diseases. PMID: 23026773
  23. Data show that human Iip35 isoform (CD74 antigen) is expressed in mouse antigen presenting cells. PMID: 22689013
  24. regulation of CD74 levels by SPPL2a is indispensable for B cell development PMID: 23267015
  25. ). Proteolytic processing of CD74 requires SPPL2A. PMID: 23267016
  26. These results emphasize the importance of Ii in B cell homeostasis and suggest that Iip35 could have regulatory functions. PMID: 22966065
  27. demonstrate here a CD74-dependent MHC class I cross-presentation pathway in dendritic cells that had a major role in the generation of MHC class I-restricted, cytolytic T lymphocyte responses to viral protein- and cell-associated antigens PMID: 22306692
  28. The cytokine midkine and its receptor RPTPzeta regulate B cell survival in a pathway induced by CD74. PMID: 22140262
  29. MIF promoted the phosphorylation of AMP-activated protein kinase (AMPK) in a CD74-dependent manner and, in turn, inhibition of AMPK reversed the inhibition of PDGF-induced hepatic stellate cell activation by MIF. PMID: 21969590
  30. iNKT developed in Ii(-/-) but not catS(-/-) mice have defective effector function. PMID: 21565221
  31. Data demonstrate that MIF and CD74 play previously unappreciated roles in CCL2-induced macrophage adhesion and migration. PMID: 21411731
  32. this study emphasizes the role of microvesicles and Ii in the communication between DC and microglia. PMID: 20816669
  33. although other regions of Ii interact with class II, CLIP binding to the groove is likely to be a dominant event in assembly of nascent class II molecules with Ii in the ER PMID: 20547545
  34. expression and function of CD74 in normal colon epithelial cells and colon carcinoma cells PMID: 20614481
  35. Data show that D74-HGF/c-Met axis defines a novel physiologic survival pathway in mature B cells, resulting in the control of the humoral immune response. PMID: 20639480
  36. We here identify Cd74 as a common insertion site in murine B-lymphomas PMID: 20416035
  37. Preferential Th1 immune response in invariant chain knockout mice PMID: 11823488
  38. structure for the trimeric MHC class II-associated invariant chain transmembrane domain PMID: 12126629
  39. Expression and function of transgenic HLA-DQ molecules and lymphocyte development in mice lacking invariant chain. PMID: 12165499
  40. major histocompatibility complex class II-associated invariant chain controls the activity of extracellular cathepsin L PMID: 12417635
  41. Ii and its isoforms are essential to mediate ovalbumin-induced pulmonary inflammation, IgE generation, and airway hyperresponsiveness in a Th2-dependent immune response. PMID: 12538710
  42. Expression of Ii blocks constitutive major histocompatibility (MHC) class II localization to plasma membrane lipid rafts and may reduce vaccine efficiency of M12.C3 B cell lymphoma and SaI-Ak sarcoma tumor vaccine cells. PMID: 14707062
  43. Ii deficiency induces cell autonomous defects of two distinct B cell lineages: the life span of mature follicular B cells is reduced, accounting for their markedly decreased frequency, whereas, in contrast, marginal zone B cells accumulate. PMID: 14764672
  44. In p41 CD74 isoform-transgenic mice on an I-A(d) background (p41-I-A(d) mice), the recovery from CNS injuries was worse than that of controls. PMID: 17182551
  45. Ii siRNA-transfected H-2(K) DCs enhanced Th1 responses. PMID: 17296316
  46. These results suggest that invariant chain-chondroitin sulfate may play an important role in the generation of cell-surface pools of invariant chain that can serve as receptors for CD44 and macrophage migration inhibitory factor. PMID: 17492940
  47. Ii-Key modified HER-2/neu776-790 hybrid peptides are sufficiently potent to provide antigen-specific CD4+ TH cells with therapeutic antitumor activity PMID: 17634957
  48. the CD74/NF-kappaB/TAp63 axis defines a novel antiapoptotic pathway in mature B cells, resulting in the shaping of both the B-cell repertoire and the immune response PMID: 17846227
  49. impact of allelic variation in CLIP affinity on immune responses will be highest in cells with limited DM activity PMID: 17947664
  50. NOS2 interacts with CD74 (the MHC II-associated invariant chain), and the degradation of CD74 by caspases in immature dendritic cells was inhibited upon treatment with nitric oxide donor. PMID: 18003616

Show More

Hide All

Subcellular Location
[Isoform Long]: Late endosome. Lysosome.; Cell membrane; Single-pass type II membrane protein. Endoplasmic reticulum membrane. Golgi apparatus, trans-Golgi network. Endosome. Lysosome.
Tissue Specificity
[Isoform Long]: Expressed in thymus and lymph noodes. Expressed by antigen-presenting cells (APCs).; [Isoform Short]: Expressed in thymus and lymph noodes.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*