Recombinant Mouse Pericentrin (Pcnt), partial

Code CSB-EP017627MO
MSDS
Size US$388
Order now
Image
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP017627MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pcnt.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP017627MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Pcnt.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Tags & Cell Markers
Alternative Names
Pcnt; Pcnt2; Pericentrin
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
2545-2810aa
Target Protein Sequence
LCAAGLLTSFTNHTVDRTIKDWTSSNEKAVSSLMRTLEELKSELSMPTSFQKKMTAELQVQLMNELLSDNDALTKAVGMATREKAELCRTVSRLEKTLKHHTQKGCVLNRQSKSSLKQDGTDLQSSLRHSDPEWHSQTTSGDTNTCNIKMEKLYLHYLRAESFRKALIYQKKYLLLLIGGFQDSEQETLSMIAHLGVFPSKADKKITMSRPFTKFRTAVRVVIAVLRLRFLVKKWQEVDRKGALVHPKSTRHGHRTSQRQRSPSGP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
37.7 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Integral component of the filamentous matrix of the centrosome involved in the initial establishment of organized microtubule arrays in both mitosis and meiosis. Plays a role, together with DISC1, in the microtubule network formation. Is an integral component of the pericentriolar material (PCM). May play an important role in preventing premature centrosome splitting during interphase by inhibiting NEK2 kinase activity at the centrosome.
Gene References into Functions
  1. experiments demonstrate a role for Pericentrin in modulating Piezo2 activity and membrane expression in somatosensory neurons PMID: 27345391
  2. Meiotic division is highly error-prone in the absence of Pcnt and disrupted acentriolar microtubule-organizing centers. PMID: 28193732
  3. Pericentrin is a key functional component of the unique acentriolar MTOCs of mouse oocytes, and plays an important role in regulating meiotic spindle assembly and/or stability. PMID: 25266793
  4. The mouse Pcnt(-/-) phenotype was associated with misdirected ventricular septal growth in the heart, decreased proliferative symmetric divisions in brain neural progenitors, and increased misoriented divisions in fibroblasts. PMID: 25220058
  5. Findings suggest distinct functional roles of several Pcnt variants in different ciliated tissues and sensory neurons, like the olfactory epithelium and the retina of the mouse PMID: 22031837
  6. A mutation in the pericentrin gene causes abnormal interneuron migration to the olfactory bulb in mice PMID: 20096683
  7. results confirm that MT1-MMP cleaves pericentrin-2 in humans but not in mice and that mouse models of cancer probably cannot be used to critically examine MT1-MMP functionality PMID: 16251193
  8. Pcnt was shown to be localized to the base of primary cilia in multiple embryonic tissues, in agreement with a recent study demonstrating the involvement of Pcnt in primary cilia formation using cultured mammalian cells. PMID: 16534625
  9. Pericentrin forms complexes with CHD3 and CHD4, but a distinct CHD3-pericentrin complex is required for centrosomal anchoring of pericentrin/gamma-tubulin and for centrosome integrity. PMID: 17626165
  10. pPKCdelta(Thr505) interacts with MTOC-associated proteins pericentrin and gamma-tubulin, and plays a role in meiotic spindle organization in oocytes PMID: 18602096
  11. pericentrin is essential for the assembly of chemosensory cilia of olfactory receptor neurons, but it is not globally required for cilia formation in mammals. PMID: 19470799

Show More

Hide All

Subcellular Location
Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Tissue Specificity
Expressed in heart and lung (at protein level). Expressed in kidney, thymus, liver, brain, muscle, testis, spleen, lung and heart.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*