Recombinant Mouse Proto-oncogene c-Fos (Fos)

Code CSB-EP008790HU
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Cellular oncogene fos;Fos proto-oncogene, AP-1 transcription factor subunit;G0/G1 switch regulatory protein 7;Proto-oncogene c-Fos;Transcription factor AP-1 subunit c-Fos
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-380aa
Target Protein Sequence
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
45.7 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. In the heterodimer, FOS and JUN/AP-1 basic regions each seems to interact with symmetrical DNA half sites. On TGF-beta activation, forms a multimeric SMAD3/SMAD4/JUN/FOS complex at the AP1/SMAD-binding site to regulate TGF-beta-mediated signaling. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. In growing cells, activates phospholipid synthesis, possibly by activating CDS1 and PI4K2A. This activity requires Tyr-dephosphorylation and association with the endoplasmic reticulum.
Gene References into Functions
  1. Findings iindicate a human bone tumour defined by mutations of FOS and FOSB. PMID: 29858576
  2. gammadelta T cells suppressed iDCs osteoclastogenesis by downregulation of the RANK/cFos/ATP6V0D2 signaling pathway. PMID: 30066839
  3. Mutant cellular AP-1 proteins promote expression of a subset of Epstein-Barr virus late genes in the absence of lytic viral DNA replication. PMID: 30021895
  4. Low c-fos expression is associated with Oral Squamous Cell Carcinoma. PMID: 29582647
  5. Study demonstrated that c-Fos was highly expressed in most of ovarian epithelial carcinoma cases and was significantly correlated with Lewis y. Also, the results revealed that c-Fos interacted with the FUT1 promoter. Silencing of c-Fos prevented TGF-beta1-induced Lewis y expression. PMID: 29130097
  6. These findings indicate that the c-Fos/miR-22/MDC1 axis plays a relevant role in DNA repair in terminally differentiated cells, which may facilitate our understanding of molecular mechanism underlying the downregulating DNA repair in differentiated cells. PMID: 28637007
  7. our results strongly suggest a novel role of c-Fos as a regulator of epithelial-mesenchymal transition and cancer stem cell(CSC) reprogramming in Head and neck squamous cell carcinoma (HNSCC)cells, which may hold potential as a CSC-directed therapeutic approach to improve HNSCC treatment PMID: 27965308
  8. High c-fos expression is associated with malignant glioma. PMID: 27602752
  9. Immunohistochemistry was employed to analyze cFos, cJun and CD147 expression in 41 UCB cases and 34 noncancerous human bladder tissues. PMID: 28358415
  10. data enforced the evidence that knockdown of c-Fos inhibited cell proliferation, migration, and invasion, and promoted the apoptosis of OS cells accompanied by altered expression of Wnt2 and Fzd9 PMID: 28665975
  11. These findings demonstrate an essential role for the ERK pathway together with c-JUN and c-FOS in the differentiation activity of LukS-PV. PMID: 27102414
  12. novel function of KDM2B in the negative regulation of cell proliferation by assembling an E3 ligase to targeting c-Fos protein degradation that is antagonized by mitogenic stimulations PMID: 26725323
  13. NF-Y Binding Site Architecture Defines a C-Fos Targeted Promoter Class PMID: 27517874
  14. c-fos underexpression is associated with Myelodysplastic Syndrome. PMID: 27513856
  15. miR-101 is downregulated in bladder cancer cells and has an inhibitory role in the regulation of bladder cancer cell proliferation and invasion via directly targeting c-FOS. PMID: 27485165
  16. We found that c-jun or c-fos was significantly associated with lymph node metastasis, and coexpression of c-jun/c-fos, or c-jun/c-fos/p53 were significantly associated with lymph node metastasis, poor differentiation and clinical stage. PMID: 27558649
  17. CRAC channel blockade also suppressed Oxo-M-induced c-fos and interleukin-2 expression PMID: 27474128
  18. The results indicate that 17beta-estradiol-induced endometrial stromal cell invasion is dependent on c-fos-mediated MMP-9 expression. PMID: 26917263
  19. FOS is a downstream effector of high glucose stimulation in peritoneal mesothelial cells that contributes to TGF-beta1 production. PMID: 26018137
  20. VEGF-induced endothelial migration is mediated primarily by induction of JunB whereas the promotion of endothelial proliferation by VEGF is mediated by JunB-independent AP-1 family members. PMID: 26860974
  21. c-Fos can protect against HDAC3 neurotoxicity. PMID: 25592718
  22. These results indicate that IL-17A enhances COX2 expression and PGE2 production via the p38/c-Fos and JNK/c-Jun signalling pathways in NP cells to mediate intervertebral disc inflammation. PMID: 26988982
  23. the results of this study suggest that FOS is among the candidate genes of schizophrenia and that changes in the expression of c-Fos protein may contribute to molecular mechanisms of schizophrenia-related alterations in synaptic plasticity. PMID: 25706621
  24. Increased c-Fos expression is through TRPM3-mediated stimulation of the c-Fos promoter. PMID: 26493679
  25. A novel AP-1 binding site at -1363 bp of the human TF promoter region was identified. PMID: 26631725
  26. Simultaneous high expression of ID1 and c-Jun or c-Fos was correlated with poor survival in esophageal squamous cell carcinoma patients. PMID: 26858249
  27. miR-146a has a role in targeting Fos expression in human cardiac cells PMID: 26112171
  28. The translocation causes truncation of the FOS protein, with loss of the transactivation domain, which is thereby a novel mechanism involved in tumorigenesis. PMID: 26173738
  29. ERK1 and ERK2 regulated the expression of c-Fos and c-Jun proteins in human cervical cancer cells. PMID: 25647783
  30. O-GlcNAcylation of MLL5beta at T440 residue is critical for MLL5 recruitment to the HPV16/18-long control region through its interaction with AP-1. PMID: 25670814
  31. The RNA binding complexes NF45-NF90 and NF45-NF110 associate dynamically with the c-fos gene and function as transcriptional coactivators. PMID: 26381409
  32. Data show that interleukin-1 receptor type 2 (IL1R2) forms a complex with c-Fos proto-oncogene protein and activates the interleukin-6 (IL-6) and vascular endothelial growth factor A (VEGF-A) promoters. PMID: 26209639
  33. Data indicate that deregulation of transcription factor AP-1 and microRNA-21-mediated axis led to an enhanced cell growth in hepatocellular carcinoma (HCC). PMID: 25544773
  34. These results establish c-Fos homodimers as a novel form of the AP-1 complex that may be an autonomous transcription factor in c-Fos-overexpressing tissues and could contribute to tumor development. PMID: 26303532
  35. Endoplasmic reticulum stress activates the hepatic AP-1 complex via MAPK-dependent signaling pathways. PMID: 25077945
  36. co-expression of c-Fos or Fra1 was able to cooperate with TAp73 in potentiating cellular growth, similarly to c-Jun. These data together suggest that TAp73 plays a vital role in activation of AP-1 target genes via direct binding to c-Jun PMID: 26018080
  37. The light-induced FOS response in melanopsin expressing HEK-293 cells is correlated with melanopsin quantity and dependent on light duration and irradiance. PMID: 24909488
  38. c-Fos promotes the progression of viral transcription from early to late stages and accelerates viral lytic replication upon sustained ORF45-ERK-RSK activation during the Kaposi's Sarcoma-Associated Herpesvirus lytic life cycle. PMID: 25903346
  39. By targeting the proto-oncogene Fos, miR-101 is involved in G1-to-S phase transition in cervical cancer cells in vitro. PMID: 24987920
  40. Data suggest that p38 MAP kinase regulates c-Fos/cellular oncogene fos mRNA stability/decay by affecting state of phosphorylation of ELAVL1/HuR (Hu antigen R). PMID: 25588078
  41. CDK12 plays an important role in cotranscriptional processing of c-FOS transcripts PMID: 25384976
  42. We found significant negative correlations regarding the expression of the genes COMT, MAOB, DRD4, DRD5 and FOS, indicating that increased schizotypy coincides with higher levels of dopaminergic dysregulation on the mRNA-level. PMID: 24630741
  43. results support the proposal that cooperative signaling of both NF-kappaB and AP1 (via p38alpha) amplifies STIM1 expression in ECs and, thereby, contributes to the lung vascular hyperpermeability response during sepsis PMID: 25016017
  44. SMAR1 has a role in repressing c-Fos-mediated HPV18 E6 transcription through alteration of chromatin histone deacetylation PMID: 25157104
  45. This study indicates that increased expression of c-Fos, p-c-Jun, members of AP-1 transcriptional factor and p-JNK is associated with neuronal degeneration in the ganglion cell layer of retinas in diabetic patients. PMID: 24073601
  46. S100A4, FOS and CXCR4, playing a major role in tumor progression and metastasis, are downregulated by sorafenib. PMID: 24378831
  47. the IL-1beta/p38/AP-1(c-fos)/MMP2 & MMP9 pathway play an important role in metastasis in gastric adenocarcinoma PMID: 24479681
  48. the distinct requirement of NF-kappaB for mouse and human c-fos regulation PMID: 24386331
  49. c-Fos, a well known AP-1 transcription factor, has emerged as a unique protein with the capacity to associate to specific enzymes of the pathway of synthesis of phospholipids at the endoplasmic reticulum and activate their synthesis. (Review) PMID: 24886961
  50. Inflammation mediators act through c-Fos to increase VEGF production in peritoneal mesothelium. PMID: 23760290

Show More

Hide All

Subcellular Location
Nucleus. Endoplasmic reticulum. Cytoplasm, cytosol. Note=In quiescent cells, present in very small amounts in the cytosol. Following induction of cell growth, first localizes to the endoplasmic reticulum and only later to the nucleus. Localization at the endoplasmic reticulum requires dephosphorylation at Tyr-10 and Tyr-30.
Protein Families
BZIP family, Fos subfamily
Database Links

HGNC: 3796

OMIM: 164810

KEGG: hsa:2353

STRING: 9606.ENSP00000306245

UniGene: Hs.25647

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*