Recombinant Rat Thyroxine 5-deiodinase (Dio3), partial (170:U→missing)

Code CSB-YP344617RA
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Dio3
Uniprot No.
Research Area
Others
Alternative Names
Dio3; Itdi3; Txdi3; Thyroxine 5-deiodinase; EC 1.21.99.3; 5DIII; DIOIII; Type 3 DI; Type III iodothyronine deiodinase
Species
Rattus norvegicus (Rat)
Source
Yeast
Expression Region
63-304aa(170:U→missing)
Target Protein Sequence
DFLCIRKHFLRRRHPDHPEPEVELNSEGEEMPPDDPPICVSDDNRLCTLASLKAVWHGQKLDFFKQAHEGGPAPNSEVVRPDGFQSQRILDYAQGTRPLVLNFGSCTUPPFMARMSAFQRLVTKYQRDVDFLIIYIEEAHPSDGWVTTDSPYVIPQHRSLEDRVSAARVLQQGAPGCALVLDTMANSSSSAYGAYFERLYVIQSGTIMYQGGRGPDGYQVSELRTWLERYDEQLHGTRPRRL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
29.5kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into RT3 (3,3',5'-triiodothyronine) and of T3 (3,5,3'-triiodothyronine) into T2 (3,3'-diiodothyronine). RT3 and T2 are inactive metabolites. May play a role in preventing premature exposure of developing fetal tissues to adult levels of thyroid hormones. Can regulate circulating fetal thyroid hormone concentrations throughout gestation. Essential role for regulation of thyroid hormone inactivation during embryological development.
Gene References into Functions
  1. findings suggest that translational repression of Dio3 is an important determinant of the reduced D3 protein expression following liver damage PMID: 23586759
  2. ischemia/hypoxia induces an Hsp40-mediated translocation of Dio3 to the nucleus, facilitating thyroid hormone inactivation proximal to the thyroid hormone receptors PMID: 22723689
  3. Data suggest that genetic background and sex modify vulnerability to prenatal alcohol via brain region-specific expression of Dio3. PMID: 21429942
  4. we show marked expression of D3 by granulocytes and macrophages in spinal cord inflammatory lesions of EAE rats. We further confirm induction of D3 expression in vitro in monocytes that were activated toward proinflammatory or immunomodulatory phenotypes PMID: 19916870
  5. Induction of D3 activity begins immediately after implantation and increases markedly over next 72 hours. In spontaneously cycling female rats, both D2 and D3 were observed to be 3- to 8-fold higher in proestrus, compared with diestrus. PMID: 12959985
  6. genomic imprinting and gene expression at the Dlk1/Dio3 imprinted domain may play a role in the regulation of adipocyte proliferation and differentiation PMID: 17510246
  7. Acute decrease in serum T(4) and T(3) after myocardial infarction is due to increased thyroid hormone catabolism from ectopic D3 expression in the heart. PMID: 17628010
  8. a mechanism of metabolic regulation during hypoxic-ischemic injury in which HIF-1 reduces local thyroid hormone signaling through induction of D3. PMID: 18259611
  9. Dio3 is important in the modulation of thyroid hormone levels in the regenerating liver, in which decrease in cellular T3 permits an increase in proliferation. PMID: 18787028

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein. Endosome membrane; Single-pass type II membrane protein.
Protein Families
Iodothyronine deiodinase family
Tissue Specificity
Neonatal skin, placenta, skeletal muscle and cerebral cortex.
Database Links

KEGG: rno:29475

UniGene: Rn.11237

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*