Recombinant human Protein BEX3

Code CSB-BP015781HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP015781HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP015781HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Research Area
Apoptosis
Alternative Names
Bex; BEX3; BEX3_HUMAN; Brain expressed X linked 3 (mouse) homolog; brain expressed; X-linked 3; Brain-expressed X-linked gene 3; Brain-expressed X-linked protein 3; DXS6984E; HGR74; NADE; Nerve growth factor receptor (TNFRSF16) associated protein 1; Nerve growth factor receptor associated protein 1; Nerve growth factor receptor-associated protein 1; NGFR-associated protein 1; NGFRAP1; Ovarian granulosa cell 13.0 kDa protein HGR74; ovarian granulosa cell protein (13kD); Ovarian granulosa cell protein; p75NTR associated cell death executor; p75NTR-associated cell death executor; Protein BEX3
Species
Homo sapiens (Human)
Expression Region
1-111aa
Target Protein Sequence
MANIHQENEEMEQPMQNGEEDRPLGGGEGHQPAGNRRGQARRLAPNFRWAIPNRQINDGMGGDGDDMEIFMEEMREIRRKLRELQLRNCLRILMGELSNHHDHHDEFCLMP
Mol. Weight
40.4kD
Protein Length
Full length
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be a signaling adapter molecule involved in p75NTR-mediated apoptosis induced by NGF. Plays a role in zinc-triggered neuronal death. May play an important role in the pathogenesis of neurogenetic diseases.
Gene References into Functions
  1. Results showed that BEX3 was overexpressed in nasopharyngeal carcinoma (NPC), and indicated a unique functional role of BEX3 in mediating the sensitivity of NPC cells to cisplatin. PMID: 28083995
  2. Structure-function analysis of NADE: identification of regions that mediate nerve growth factor-induced apoptosis PMID: 11830582
  3. suppresses cell growth in vivo, when expressed in cultured cells PMID: 12739005
  4. DRG-1 may contribute to the dopamine-induced cell growth, which is negatively regulated by NADE PMID: 16777077
Subcellular Location
Nucleus. Cytoplasm.
Protein Families
BEX family
Tissue Specificity
Found in ovarian granulosa cells, testis, prostate and seminal vesicle tissue. High levels also detected in liver.
Database Links

HGNC: 13388

OMIM: 300361

KEGG: hsa:27018

STRING: 9606.ENSP00000299872

UniGene: Hs.448588

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1