Recombinant Mouse Serum amyloid A-3 protein (Saa3), partial

In Stock
Code CSB-EP361411MO
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP361411MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) SAA3.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP361411MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) SAA3.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Saa3; Serum amyloid A-3 protein
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
20-122aa
Target Protein Sequence
RWVQFMKEAGQGSRDMWRAYSDMKKANWKNSDKYFHARGNYDAARRGPGGAWAAKVISDAREAVQKFTGHGAEDSRADQFANEWGRSGKDPNHFRPAGLPKRY
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
15.8kDa
Protein Length
partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The preparation of this recombinant Mouse Saa3 protein was to use gene recombination DNA technology to obtain a recombinant vector connected with a Saa3 fragment (20-122aa) that could be translated into the Saa3 protein and then transferred it into E.coli cells to express the recombinant Saa3 protein molecule. In order to get the target protein with high purity, N-terminal 6xHis tag was used in the production. The purity is 90% determined by SDS-PAGE.

Serum amyloid A3 (Saa3) derives mainly from extrahepatic tissue and is not detected in plasma from moderately inflamed obese mice. In contrast, it is present in plasma from mice acutely inflamed by injection of high dose of lipopolysaccharide (LPS). To reconcile these differences, we evaluated whether different acute inflammatory stimuli could affect the presence of Saa3 in plasma. Saa3 appeared dose dependently in plasma after LPS injection. In contrast, only very low levels were detected after sterile inflammation with silver nitrate despite levels of Saa1 and Saa2 being comparable to high dose LPS. Saa3 was not detected in plasma following casein administration. Although most Saa3 was found in HDL, a small amount was not lipoprotein associated. Saa3 is commonly regarded as an extrahepatic form of Saa secreted by cells such as macrophages and adipocytes in species such as mice, although it also can be made at low levels by hepatocytes. SAA3 is a pseudogene in humans and some primates because of a frameshift mutation that generates a downstream stop signal, such that no SAA3 mRNA or SAA3 protein has been identified in humans.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

We request pricing for the following:
500ug of CSB-EP361411MO (lot #03119), endotoxin-removal
200ug of CSB-EP361411MO (lot #03119), with endotoxin-removal performed multiple times (at least twice)
Are there any extra charges for performing endotoxin-removal twice?

A:
Sorry, we can only guarantee that the final endotoxin level is less than 1EU/ug, what's your requirement for the endotoxin level ?
We worry about that the final endotoxin level will not be extremely low even if we perform multiple times.
There isn't any extra charges for performing endotoxin-removal twice, but we can't guarantee to meet your demand.
Lead time is the same for one time or multiple times endotoxin removal operation,and there is no extra charges.

Target Background

Function
Major acute phase reactant. Apolipoprotein of the HDL complex.
Gene References into Functions
  1. High SAA3 expression in the stromal component is associated with pancreatic tumors. PMID: 29351990
  2. This study suggests that the level of expression of the Saa3 gene could be utilized for the number of infiltrated macrophages in obese adipose tissue. PMID: 27929048
  3. BMDC lacking SAA3 demonstrate an impaired endotoxin tolerance response and inhibited responses to retinoic acid. Our findings indicate that endogenous SAA3 modulates metabolic and immune homeostasis PMID: 29390039
  4. The induction of Saa3 by PTH may explain the suppression of bone formation when PTH is applied continuously and may be a new therapeutic target for osteoporosis. PMID: 26703472
  5. results also suggest that Saa3 influences liver-specific SAA1/2 expression, and that SAA3 could play a larger role in the acute phase response than previously thought PMID: 25251243
  6. Expression of Saa3 in osteoblasts positively correlates with increased cellular maturation toward the osteocyte phenotype. PMID: 25491310
  7. Serum amyloid A is a retinol binding protein that transports retinol during bacterial infection. PMID: 25073702
  8. these data suggest a novel mechanism by which Mo MDSCs mediate inflammation through SAA3-TLR2 signaling and thus exacerbate cancer progression by a STAT3-dependent mechanism. PMID: 24659444
  9. Hypoxia leads to a substantial increase in SAA3 mRNA and protein level, apparently in a time-dependent manner (threefold in 48 h), in fully differentiated 3T3-L1, followed by reestablishment of gene expression to basal levels after 24 h of reoxygenation. PMID: 23605472
  10. Using various synthetic peptide fragments, it was shown that SAA3 directly binds MD-2 and activates the MyD88-dependent TLR4/MD-2 pathway, induced IL-6 and TNF-alpha, and recruited CD11b(+)Gr-1(+) cells to the lung. PMID: 23858030
  11. HSV-1 induces and activate TLR2 and TLR4 receptors directly through interaction of astrocytes with the pathogen and also indirectly by endogenous ligands produced locally, such as serum amyloid A, potentiating the neuroinflammatory response. PMID: 22622619
  12. Saa3 is expressed in the lungs of mice exposed to several mixed T helper (Th) type 2/Th17-polarizing allergic sensitization regimen and is implicated in the pathogenesis of experimental allergic asthma. PMID: 21622869
  13. cAMP in combination with TNF specifically induced C/EBPbeta protein, leading to enhanced SAA3 expression but requiring NF-kappaB in mouse granulose cells. The data indicate SAA may play a role in events occurring during the ovulation process. PMID: 20444945
  14. A 210-bp fragment of the mouse SAA3 promoter when placed in front of the LacZ gene was sufficient to confer basal and inflammation-induced reporter gene expression. PMID: 11791617
  15. tumor necrosis factor-alpha likely increased serum amyloid A 3 promoter activity and protein by activating nuclear factor-kappaB signaling via tumor necrosis factor receptor 1 in mouse granulosa cells PMID: 14749357
  16. Adipocyte hypertrophy leads to increased production of SAA and hyaluronan, which srecruit and retains monocytes, thereby leading to local inflammation in adipose tissue. PMID: 17563062
  17. These data show a potent upregulation of SAA3 by IL-1beta. PMID: 18452164
  18. In adipose tissue Saa3 was the predominant isoform and the earliest inflammatory marker induced, suggesting it is important for initiation of adipose tissue inflammation. PMID: 18584041
  19. Results indicate that the expression of SAA3 in adipose tissue is upregulated by obesity, but it does not contribute to the circulating pool of SAA in mice. PMID: 19286646
  20. serum amyloid A3 (SAA3) is regulated in mouse colonic epithelium and adipose tissue by the intestinal microbiota PMID: 19513118

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
SAA family
Tissue Specificity
Found in various tissues.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*