Product Details

Target Names

ADTRP

Uniprot No.

Q96IZ2

Research Area

Others

Alternative Names

ADTRP; C6orf105; Androgen-dependent TFPI-regulating protein; Fatty acid esters of hydroxy fatty acids hydrolase ADTRP; FAHFA hydrolase ADTRP

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

1-230aa

Target Protein Sequence

MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Tag Info

C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it’s possible to develop.

Form

Lyophilized powder
Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.

Buffer

Lyophilized from PBS, 6% Trehalose, pH 7.4

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Hydrolyzes bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), but not other major classes of lipids. Show a preference for FAHFAs with branching distal from the carboxylate head group of the lipids. Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro).

Gene References into Functions

These data suggest that one molecular mechanism by which androgen confers protection against coronary artery disease is stimulation of ADTRP expression. PMID: 28645652
ADTRP positively regulates PIK3R3 expression, which leads to activation of AKT and up-regulation of MIA3/TANGO1, thereby regulating endothelial cell functions directly relevant to atherosclerosis. PMID: 28341552
ADTRP increases the number of S phase cells during cell cycle. PMID: 27235449
These results indicate that AIG1 and ADTRP are founding members of an evolutionarily conserved class of transmembrane threonine hydrolases involved in bioactive lipid metabolism. PMID: 27018888
association of ADTRP with the pathogenesis of early-onset CAD PMID: 26375920
SNP rs6903956 associated with asymptomatic hyperuricemia susceptibility in Han Chinese PMID: 25928384
Activation of PPARG increases the expression of C6ORF105 in human macrophages and atherosclerotic lesions. PMID: 25595457
ADTRP polymorphism is associated with the development of coronary atherosclerosis. PMID: 24573017
The single nucleotide polymorphism rs6903956 within the ADTRP gene on chromosome 6p24.1 is significantly associated with coronary artery disease in different ethnic groups of the Singaporean population. PMID: 23337689
This study confirms ADTRP expression and colocalization with TFPI and caveolin-1 in endothelial cell. PMID: 21868574