Recombinant Human Cytochrome c1, heme protein, mitochondrial (CYC1)

Code CSB-CF006327HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Complex III subunit 4; Complex III subunit IV; CY1_HUMAN; CYC1; Cytochrome b c1 complex subunit 4 ; Cytochrome b-c1 complex subunit 4; Cytochrome bc1 complex subunit 4 ; Cytochrome c 1; Cytochrome c-1; Cytochrome c1; heme protein; mitochondrial; Ubiquinol cytochrome c reductase complex cytochrome c1 subunit; Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit; UQCR4
Species
Homo sapiens (Human)
Expression Region
85-325
Target Protein Sequence
SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCYTEDE AKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIVRAR HGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMS QIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLVPLVYTIKRHKWSVLKSRKLAYRPP K
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
10xHis-SUMO-tag
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the ubiquinol-cytochrome c oxidoreductase, a multisubunit transmembrane complex that is part of the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. The cytochrome b-c1 complex catalyzes electron transfer from ubiquinol to cytochrome c, linking this redox reaction to translocation of protons across the mitochondrial inner membrane, with protons being carried across the membrane as hydrogens on the quinol. In the process called Q cycle, 2 protons are consumed from the matrix, 4 protons are released into the intermembrane space and 2 electrons are passed to cytochrome c. Cytochrome c1 is a catalytic core subunit containing a c-type heme. It transfers electrons from the [2Fe-2S] iron-sulfur cluster of the Rieske protein to cytochrome c.
Gene References into Functions
  1. these results indicate that CYC1 plays important roles in cell proliferation and comedo necrosis through the elevated oxidative phosphorylation activity in human ductal carcinoma in situ PMID: 28394473
  2. results indicate that miR-661 plays a tumor suppressor role in OS mediated by the downregulation of CYC1, suggesting a potential mechanism underlying cell death resistance in Osteosarcoma. PMID: 28391262
  3. CYC1 promoted tumor metastasis via suppressing activation of AMPK and contributed to tumor growth via facilitating production of ATP. PMID: 27239088
  4. FASL, granzyme B, and cytochrome c blood expression reflects breast cancer progression and response to therapy. (Review) PMID: 27117663
  5. our results provide evidence that CYC1 plays an important role in OS tumorigenesis, and modulation of CYC1 may be an effective strategy to potentiate OS to apoptotic induction by TRAIL. PMID: 25562155
  6. Mutations in CYC1 cause insulin-responsive hyperglycemia. PMID: 23910460
  7. HeLa cells expressing non-cleavable cytochrome c1 maintain mitochondrial morphology and functions. PMID: 21577235
  8. Decreased electron Transport Complex IV activity is associated with ulcerative colitis. PMID: 20440543
  9. Addition of H202 to tendon fibroblasts in vitro resulted in oxidative stress-induced apoptosis and the release of CYC1. PMID: 12788227
  10. the Ca(2+) spike, mitochondrial Bcl-2 presensitization, and subsequent Delta psi(m) transition, Bax translocation, and ROS generation are important upstream signals for cytochrome c release upon stimulation by a Bcl-2 inhibitor. PMID: 14966123
  11. Sensitivity of Cyt c detection in -linked immunosorbent assay is reduced in the presence of serum leucine-rich alpha-2-glycoprotein-1. PMID: 16699948

Show More

Hide All

Involvement in disease
Mitochondrial complex III deficiency, nuclear 6 (MC3DN6)
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.
Protein Families
Cytochrome c family
Database Links

HGNC: 2579

OMIM: 123980

KEGG: hsa:1537

STRING: 9606.ENSP00000317159

UniGene: Hs.289271

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1