Recombinant Human Membrane-spanning 4-domains subfamily A member 6A (MS4A6A)

Code CSB-CF875659HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
MS4A6A
Uniprot No.
Alternative Names
MS4A6A; 4SPAN3; CD20L3; MS4A6; CDA01; MSTP090; Membrane-spanning 4-domains subfamily A member 6A; CD20 antigen-like 3; Four-span transmembrane protein 3
Species
Homo sapiens (Human)
Expression Region
1-248
Target Protein Sequence
MTSQPVPNETIIVLPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVL SLGIILASASFSPNFTQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVG SILSALSALVGFIILSVKQATLNPASLQCELDKNNIPTRSYVSYFYHDSLYTTDCYTAKA SLAGTLSLMLICTLLEFCLAVLTAVLRWKQAYSDFPGSVLFLPHSYIGNSGMSSKMTHDC GYEELLTS
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be involved in signal transduction as a component of a multimeric receptor complex.
Gene References into Functions
  1. Meta analysis validated the Alzheimer disease protective association for MS4A6A (rs610932) variants. PMID: 29504051
  2. rs610932 MS4A6A is not associated with late-onset Alzheimer's disease. PMID: 28477215
  3. these findings reveal that MS4A6A genotypes affect Alzheimer's disease specific brain structures PMID: 27244883
  4. Study found enrichment of epistasis in gonadotropin-releasing hormone signaling with risk single-nucleotide polymorphisms in APOE and MS4A6A. Results suggest that in addition to APOE, MS4A6A polymorphisms should be considered in hormone trials targeting gonadotropins. PMID: 27337227
  5. identified the significant associations of the GBA L444P mutation and DYRK1A rs8126696 T allele with the earlier age at onset (AAO) in Parkinson's disease (PD) patients, and the A allele at MS4A6A rs610932 with the delayed AAO of PD. PMID: 27085534
  6. Common variants in ABCA7 and MS4A6A are associated with cortical and hippocampal atrophy. PMID: 26923404
  7. high levels of MS4A6A contribute to altered turnover or production of cells with an anti-inflammatory neuroprotective phenotype in favor of cells with a damaging pro-inflammatory phenotype believed to contribute to AD pathology. PMID: 24064185
  8. data revealed the allele (T) of the rs3865444 polymorphism of the CD33 gene and the allele (C) of the rs610932 polymorphism of the MS4A6A gene may contribute to Alzheimer's disease risk in the Chinese Han population PMID: 22382309
  9. ABCA7 and the MS4A6A/MS4A4E gene cluster are new Alzheimer's disease susceptibility loci. PMID: 21460840

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
MS4A family
Tissue Specificity
Variable expression in some B-cell, myelomonocytic, and erythroleukemia cell lines.
Database Links

HGNC: 13375

OMIM: 606548

KEGG: hsa:64231

STRING: 9606.ENSP00000315878

UniGene: Hs.523702

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1