Recombinant Human Probetacellulin (BTC)

Code CSB-CF002853HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
BTCProbetacellulin [Cleaved into: Betacellulin; BTC)]
Species
Homo sapiens (Human)
Expression Region
32-178
Target Protein Sequence
DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth factor that binds to EGFR, ERBB4 and other EGF receptor family members. Potent mitogen for retinal pigment epithelial cells and vascular smooth muscle cells.
Gene References into Functions
  1. Our results suggest that betacellulin induces ovarian cancer migration and Slug-dependent E-cadherin down-regulation PMID: 27129169
  2. CXCL8 production from lung cancer cells could be initiated by an autocrine mechanism or external sources of BTC. PMID: 24629040
  3. Data suggest that BTC (betacellulin), AREG (amphiregulin), and EREG (epiregulin) induced prostaglandin E2 production by induction of COX-2 (prostaglandin-endoperoxide synthase 2) through MAP kinase signaling in granulosa cells. PMID: 24092824
  4. BTC has properties of increasing retinal vascular leakage that could contribute to the development of diabetic retinopathy. PMID: 22183345
  5. Data suggest a novel receptor-independent role for betacellulin intracellular-domain fragment signaling due to its ability to inhibit cell growth in vitro. PMID: 20530572
  6. These are the first data that demonstrate an influence of betacellulin upon mesenchymal stem cells and the first to implicate HIF-alpha in betacellulin-mediated proliferation. PMID: 20165885
  7. The solution structure of the EGF-like domain of betacellulin has been determined using two-dimensional nuclear magnetic resonance spectroscopy PMID: 12074582
  8. The main structural properties of the model and the templates are compared and the hBTC conformation is closely similar to that of hTGFalpha. PMID: 12111392
  9. Betacellulin and heregulin/NDF-alpha are involved in epidermal morphogenesis and/or in maintenance of the differentiated phenotype. PMID: 12768307
  10. although BTC and EGF share overlapping signaling properties, the ability of BTC to enhance Erk activation occurs independent of Ras. PMID: 15192046
  11. BTC may play a pivotal role as a local growth factor in promoting the differentiated villous trophoblastic function via ErbB-1 in early placentas and in contributing to placental growth through EVT cell function via ErbB-4 in term placentas. PMID: 15248827
  12. Betacellulin is expressed in malignant fibrous histiocytoma and is a regulator of tumor growth. PMID: 15274392
  13. shedding of precursor is mediated by ADAM10 PMID: 15507448
  14. To determine if mutations in the betacellulin gene play a role in the development of type 2 diabetes, we screened subjects with type 2 diabetes for the presence of mutations. PMID: 15793259
  15. Genetic variations in the protein-coding region of the human BTC gene are unlikely to be a major contributor to development of type 2 diabetes. PMID: 15936459
  16. -226A/G polymorphism of the BTC gene may contribute to the development of diabetes. PMID: 16306376
  17. intron 4 T-4 allele in the betacellulin gene is associated with lower risk of type 1 diabetes mellitus and may interact with human leukocyte antigen PMID: 16683131
  18. Failure to confirm a role for nonsynonymous coding variants of betacellulin in the propensity to type 2 diabetes or to impaired insulin secretion in African American subjects. PMID: 16869959
  19. Variants in the betacellulin gene do not play a major role in the development of type 2 diabetes in an Amish Caucasian populations PMID: 17479438
  20. the ADAM10 prodomain inhibits betacellulin shedding, demonstrating that it could be of potential use as a therapeutic agent to treat cancer. PMID: 17895248
  21. 1st report of BTC expression in breast cancer. Its expression was lower in lobular breast cancers than in ductal carcinomas. PMID: 17962208
  22. These results indicate the possibility of designing BTC mutants, which have an activity of inducing differentiation only, without facilitating growth promotion. PMID: 18508082
  23. In vivo, EGFR signaling is hyperactive in tumor cells of skin SCC but not of BCC, and in nearby asymptomatic epidermis of both tumor types. Hyperactivation is due to upregulation of EGFR ligands AREG, HBEGF and TGFA, and downregulation of BTC PMID: 17525275

Show More

Hide All

Subcellular Location
[Betacellulin]: Secreted, extracellular space.; [Probetacellulin]: Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Synthesized in several tissues and tumor cells. Predominantly expressed in pancreas and small intestine.
Database Links

HGNC: 1121

OMIM: 600345

KEGG: hsa:685

STRING: 9606.ENSP00000379092

UniGene: Hs.591704

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1