Recombinant Human Prostaglandin E2 receptor EP2 subtype (PTGER2)

Code CSB-CF018971HU
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
PTGER2; Prostaglandin E2 receptor EP2 subtype; PGE receptor EP2 subtype; PGE2 receptor EP2 subtype; Prostanoid EP2 receptor
Species
Homo sapiens (Human)
Expression Region
1-358
Target Protein Sequence
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. The subsequent raise in intracellular cAMP is responsible for the relaxing effect of this receptor on smooth muscle.
Gene References into Functions
  1. EP receptor levels were enhanced in human PASMCs and in lung sections from PAH patients compared to controls. Thus, EP receptors represent a novel therapeutic target for treprostinil, highlighting key pharmacological differences between prostacyclin mimetics used in pulmonary arterial hypertension. PMID: 30103548
  2. PGE2 produced by mesenchymal stem cells contributes to maintenance of self-renewal capacity through EP2 in an autocrine manner, and PGE2 secretion is down-regulated by cell-to-cell contact. PMID: 27230257
  3. this study shows that prostaglandin E2 restrains human Treg cell differentiation via E prostanoid receptor 2-protein kinase A signaling PMID: 28963072
  4. in breast cancer cells overexpression of S1P3 and its activation by S1P has pro-inflammatory and pro-metastatic potential by inducing COX-2 expression and PGE2 signaling via EP2 and EP4. PMID: 27616330
  5. EP2 and EP3 receptors are involved in tolerance induction through IL-10 production by tol-DCs. PMID: 28630103
  6. This is the first report that PGE2 -induced uPAR expression, which stimulates invasiveness of human gastric cancer AGS cells, is mediated by the EP2 receptor-dependent Src/EGFR/JNK1/2, Erk1/2/AP-1, and Src/EGFR/JNK1/2, Erk1/2/NF-kappaB cascades. PMID: 27377703
  7. These results indicate that the ICL2 region of the EP2 receptor is its potential interaction site with Galphas, and that the aromatic side chain moiety at position 143 is a determinant for the accessibility of the ICL2 to the Galphas protein. PMID: 28336329
  8. EP2 receptor activation protects against endoplasmic reticulum stress-dependent mitochondrial apoptosis through down-regulation of p53. PMID: 27321910
  9. that the expression of ERG in prostate cancer is linked to the expression of IL-6 mediated by the prostanoid receptor EP2 PMID: 27012192
  10. mPGES-1 is downregulated via EGR1 and has a role in caffeine inhibition on PGE2 synthesis of HBx hepatocytes PMID: 26538827
  11. Altered expression of EP2 in patients with aspirin-exacerbated respiratory disease contributes to deficient induction of IL-1RI, reducing the capacity of IL-1beta to increase COX-2 and mPGES-1 expression, which results in low PGE2 production PMID: 26560040
  12. Reduced EP2 receptor expression results in resistance to the antiproliferative effects of EP2 signaling in nasal polyp fibroblasts from subjects with AERD and support a role for EP2 signaling in the aberrant growth of nasal polyp tissue. PMID: 26051534
  13. Intracellular EP2 prostanoid receptor promotes cancer-related phenotypes in PC3 prostate cancer cells. PMID: 25828575
  14. In adjusted models, gestations were 3.3 days longer (95%CI 0.6, 6.0) for each interquartile range of PTGER2 DNA methylation. PMID: 24827772
  15. data show a protective role for the PGE2 receptors EP(2) and EP(4) following osmotic changes, through the reduction of human mast cell activity caused by calcium influx impairment and MAP kinase inhibition. PMID: 25329458
  16. mediates inhibitory effect of Prostaglandin E2 on nasal fibroblast migration PMID: 24980222
  17. Overall, our results demonstrate that p53 is a negative regulator of aromatase in the breast and its inhibition by PGE2 provides a novel mechanism for aromatase regulation in obesity and breast cancer. PMID: 25634217
  18. PGE2 markedly enhanced Huh-7 cell invasion and migration ability by upregulating the expression level of Snail protein, and EP2 receptor played an important role in this process. PMID: 24626807
  19. Overexpression of EP2 was more observed in esophageal squamous cell carcinoma than in the control group. Overexpression of EP2 ESCC tissues might play an important role in carcinogenesis and the progression of ESCC. PMID: 24883443
  20. EP2/cAMP/protein kinase A pathway mediates the stimulatory effect of PGEs on angiogenesis essential for tissue injury healing via the induction of CREB activity and VEGF expression. PMID: 25059824
  21. In Th17 cells, RORC repressed EP2 by directly silencing PTGER2 transcription, and knock down of RORC restored EP2 expression in Th17 cells. PMID: 24812667
  22. The 15-PGDH gene is a MiTF-CX target gene in cervical stromal cells and is down-regulated by PGE2 through EP2 receptors. PMID: 24471568
  23. human albumin solution infusions may be used to reduce circulating PGE2 levels, attenuating immune suppression and reducing the risk of infection in patients with acutely decompensated cirrhosis or ESLD. PMID: 24728410
  24. cyclic tensile force activates ERK1/2 and p38 MAP kinase signaling pathways, and induces COX-2 expression, which is responsible for the sequential PGE2 biosynthesis and release, and mediates the increase in BMP-2 expression at the transcriptional level. PMID: 24561081
  25. Elastogenesis is spatially regulated by PGE-EP4 signaling in the ductus arteriosus. PMID: 24146253
  26. Although human lung mast cells may express both EP2 and EP4 receptors, the principal mechanism by which PGE2 inhibits mediator release in mast cells is by activating EP2 receptors. PMID: 23786281
  27. Data suggest that elevated PGE2 (prostaglandin E2) in peri-implantation uterine lumen stimulates conceptus PTGER2 expression, which in turn promotes trophoblast adhesion via integrins and synthesis/secretion of embryonic signal estradiol-17. PMID: 23861370
  28. Loss of function of EP2- and EP4-mediated PGE2 signaling inhibits adhesion of human endometriotic epithelial and stromal cells through integrin-mediated mechanisms. PMID: 23242524
  29. PGE(2) coordinates control of IL-23 release in a dose-dependent manner by differential use of EP(2) and EP(4) receptors in LPS-activated MoDCs. PMID: 23337716
  30. The expression of the EP2 receptor and Bcl-2 was significantly increased. PMID: 23069790
  31. Targeted interference of EP2/EP4 signal to RalA.GTP may provide benefit to patients diagnosed with advanced kidney cancer. PMID: 22580611
  32. This review article presents a short overview of experimental approaches aimed at manipulation of signaling via EP2 and EP4 receptors that could have therapeutic utility. PMID: 22706114
  33. HB9 binds to the prostaglandin E receptor 2 promoter and inhibits intracellular cAMP mobilization in leukemic cells. PMID: 23048027
  34. Although EP2 methylation status is inversely correlated to expression levels in established breast cancer cell lines, we could not identify that such a correlation existed in tumour-associated stroma cells. PMID: 22929011
  35. Single nucleotide polymorphism in PTGER2 associated with multiple adenomas. PMID: 22551900
  36. Indomethacin has a potential antagonizing effect on human EP(2) receptors. PMID: 22329897
  37. morin inhibited the production of NO and PGE(2). PMID: 22244821
  38. This study suggested that antipsychotics showing association with PGE2-mediated respons. PMID: 22099390
  39. EP2 receptor FuEP2/Ex2 may have a role in suppressing endometrial cancer cell growth PMID: 21419570
  40. PGE2 induces IL-6 in orbital fibroblasts through EP2 receptors and increased gene promoter activity PMID: 21209948
  41. Data show that inhibition of PGE2 receptors EP2 and EP4 suppresses expression and/or activity of MMP1, MMP2, MMP3, MMP7 and MMP9 proteins and increases expression of TIMP1, TIMP2, TIMP3, and TIMP4 proteins. PMID: 21111772
  42. Data suggest that early embryonic signals may regulate fetal-maternal crosstalk in the human endometrium by inducing CXCR4 expression via the PGE-PTGER2-mediated induction of the EGFR, PI3K and ERK1/2 pathways. PMID: 20705717
  43. Data demonstrate that down-regulation of PTGER2 and consequent PGE2 resistance are both mediated by DNA hypermethylation; increased Akt signal transduction is a novel mechanism that promotes DNA hypermethylation during fibrogenesis. PMID: 20889571
  44. miR-16 and miR-21 are directly regulated by the transcription factor NF-kappaB and yet nicotine-promoted cell proliferation is mediated via EP2/4 receptors. PMID: 21081469
  45. Prostaglandin E2 receptor subtype EP2 and EP4 regulated gene expression profiling in ciliary smooth muscle cells. PMID: 20551148
  46. The mRNA levels of EP2 implicated pathways differed significantly in gliomas according to the histological type. PMID: 20382140
  47. E prostanoid (EP) 2 and EP3 have roles in cAMP/protein kinase A- and PI3-K/Akt-dependent NF-kappaB activation during shear-induced interleukin-6 synthesis in chondrocytes PMID: 20516073
  48. analysis of expression of serum vitamin D receptor, cyclooxygenase-2, and 15-hydroxyprostaglandin dehydrogenase in benign and malignant ovarian tissue and 25-hydroxycholecalciferol and prostaglandin E2 in ovarian cancer patients PMID: 20304053
  49. EP1 and EP4 subtypes of prostaglandin E receptors (but not EP2 and EP3 receptors) may be involved in regulation of paracellular permeability in differentiated Caco-2 cell cultures. PMID: 20484658
  50. EP2 is a novel transcriptional target of Wnt3a in dermal papilla cells of human scalp hair follicles PMID: 20347274

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Placenta and lung.
Database Links

HGNC: 9594

OMIM: 176804

KEGG: hsa:5732

STRING: 9606.ENSP00000245457

UniGene: Hs.2090

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1