Recombinant Rat Prostaglandin E2 receptor EP3 subtype (Ptger3)

Code CSB-CF018972RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
Ptger3; Prostaglandin E2 receptor EP3 subtype; PGE receptor EP3 subtype; PGE2 receptor EP3 subtype; Prostanoid EP3 receptor
Species
Rattus norvegicus (Rat)
Expression Region
1-365
Target Protein Sequence
MAGVWAPEHSVEAHSNQSSAADGCGSVSVAFPITMMVTGFVGNALAMLLVVRSYRRRESK RKKSFLLCIGWLALTDLVGQLLTSPVVILVYLSQRRWEQLDPSGRLCTFFGLTMTVFGLS SLLVASAMAVERALAIRAPHWYASHMKTRATPVLLGVWLSVLAFALLPVLGVGRYSVQWP GTWCFISTGPAGNETDSAREPGSVAFASAFACLGLLALVVTFACNLATIKALVSRCRAKA AASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLIMMLKMIFNQMSVEQCKTQMGKEKE CNSFLIAVRLASLNQILDPWVYLLLRKILLRKFCQIRDHTNYASSSTSLPCPGSSVLMWS DQLER
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for prostaglandin E2 (PGE2). Required for normal development of fever in response to pyrinogens, including IL1B, prostaglandin E2 and bacterial lipopolysaccharide (LPS). Required for normal potentiation of platelet aggregation by prostaglandin E2, and thus plays a role in the regulation of blood coagulation. Required for increased HCO3(-) secretion in the duodenum in response to mucosal acidification, and thereby contributes to the protection of the mucosa against acid-induced ulceration. Not required for normal kidney function, normal urine volume and osmolality.; Receptor for prostaglandin E2 (PGE2); ligand binding activates a signaling cascade via G(i) proteins that leads to the inhibition of adenylate cyclase.; Receptor for prostaglandin E2 (PGE2); ligand binding can activate several distinct signaling cascades, resulting in activation or inhibition of adenylate cyclase.
Gene References into Functions
  1. that EP3 might exert its pro-apoptotic function on neuronal apoptosis PMID: 26718710
  2. EP(3) receptors located presynaptically on sympathetic nerve fibers supplying the heart of pithed rats strongly inhibit the neurogenic tachycardia. PMID: 23406763
  3. Inhibition of prostaglandin E receptor 3 (EP) receptors, blocked Ca oscillations in smooth muscle cells and airway contraction induced by local epithelial injury. PMID: 23221044
  4. Our data suggest that the diabetes-related enhancement of EP3 receptor-mediated vasocontraction results from activation of the PKCdelta pathway. PMID: 22371141
  5. The EP(3) mRNA was mainly found in thalamus and hypothalamus in rats. PMID: 22061836
  6. EP3 receptors were expressed in forebrain neurons and were induced in endothelial cells after hypoxic-ischemic injury in the neonatal rat. Activation by misoprostol reduced the injury. PMID: 21939736
  7. the signaling pathway underlying PGE2-induced smooth muscle contraction in rat mesenteric artery PMID: 21463619
  8. Prostanoid EP3 receptor modulates urinary bladder activity and, in addition, regulates urine flow in the conscious rat. PMID: 19486006
  9. After partial sciatic nerve ligation PGE2 is one of the possible prostaglandins[PGs] overproduced in injured nerve and PG overproduction is involved in the up-regulation of EP receptors in injured nerve PMID: 14552899
  10. We investigated the participation of the prostanoid EP3 receptor, the target of PGE2 in the brain, in behavioral suppression induced by Delta8-tetrahydrocannabinol (Delta8-THC), using a one-lever operant task in rats PMID: 14675158
  11. Pronociceptive effects of spinal PGE2 can be limited through activation of an inhibitory splice variant of the EP3 receptor. The latter might be an interesting target for controlling spinal hyperexcitability in inflammatory pain states PMID: 14736850
  12. activation of EP3 receptor downregulates cAMP formation and may counteract the upregulation of cAMP formation via prostaglandin e2 receptors, which has been linked to the anti-inflammatory effects of prostaglandins PMID: 15234107
  13. EP3 and EP4 receptors are involved in the regulation of duodenal bicarbonate secretion as well as the maintenance of the mucosal integrity of the duodenum against acid injury. PMID: 17512019
  14. role of E prostanoid receptors EP1, EP2, & EP3 and F prostanoid receptors in enhancing the growth-stimulatory effect of epidermal growth factor in cultured hepatocytes PMID: 17567965
  15. Prostaglandin E2 attenuates preoptic expression of GABAA receptors via EP3 receptors PMID: 18292084
  16. EP3 receptors are involved in the regulation of bladder micturition and bladder nociception at the peripheral level. PMID: 18562635
  17. EP3 receptors are involved in bladder micturition at supraspinal and spinal centers and in bladder nociception at the spinal cord PMID: 18632791
  18. Hypertonicity stimulates PGE2 signaling in the renal medulla by promoting Ptger3 expression. PMID: 18843255
  19. Action at neuronal EP3 receptors has a deleterious effect on cholinergic neurons causing neurite retraction and cell death. PMID: 19555672

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Principally expressed in the tubules of the renal medulla. Specific expression is seen in medullary and cortical thick ascending limbs; lower levels are detected in cortical and inner medullary collecting ducts. Not detected significantly in the glomeruli
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1